SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007454 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007454
Domain Number 1 Region: 20-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-26
Family V set domains (antibody variable domain-like) 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007454   Gene: ENSAMEG00000007092   Transcript: ENSAMET00000007768
Sequence length 132
Comment pep:novel scaffold:ailMel1:GL200247.1:98:628:1 gene:ENSAMEG00000007092 transcript:ENSAMET00000007768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWIPVLLMLLSHCTGSLTQSVLTQPPFLSSSLGSSTRFTCTLSSGFNAGGYGIAWYQQQ
PGSPPRYLLYYYLSTELGSVVPSRFSGSKDASANAGLLLISGLQPEDEADYFCATAQWNK
EEVRQKPLQQQT
Download sequence
Identical sequences G1LKI8
ENSAMEP00000007454 ENSAMEP00000007454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]