SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007693 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007693
Domain Number 1 Region: 10-99
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 2.66e-18
Family Prokaryotic type KH domain (KH-domain type II) 0.0000242
Further Details:      
 
Domain Number 2 Region: 110-178
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 0.000000000000419
Family Ribosomal protein S3 C-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007693   Gene: ENSAMEG00000007309   Transcript: ENSAMET00000008014
Sequence length 234
Comment pep:novel scaffold:ailMel1:GL192539.1:1766205:1766931:-1 gene:ENSAMEG00000007309 transcript:ENSAMET00000008014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAQISKKRKFVAYGIFKAELNEFLIRELAEEGYSGVEVQVTPTKTEIIILAIRMQNVLS
EKDRRIWESTAVVQKRFGFPEGTEELHAEKVATRGLCALVPAEALLGGDLQFSMESGAKG
SEVVVSGKLQGQRAKFMKCVNDLLIHRGDPASYYADTAVCHVLLRQGVLAIKVRIVLPWD
PSAKTGPKKPRLDHVSIMEPKKEILPTTAISEQRGGKPELLPSHSQYPQYNRVS
Download sequence
Identical sequences G1LL71
ENSAMEP00000007693 ENSAMEP00000007693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]