SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007760 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007760
Domain Number 1 Region: 266-395
Classification Level Classification E-value
Superfamily ApaG-like 7.06e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 85-251
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.19e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 2-67
Classification Level Classification E-value
Superfamily F-box domain 4.19e-16
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000007760
Domain Number - Region: 404-436
Classification Level Classification E-value
Superfamily ARM repeat 0.0023
Family Armadillo repeat 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007760   Gene: ENSAMEG00000007335   Transcript: ENSAMET00000008085
Sequence length 456
Comment pep:known_by_projection scaffold:ailMel1:GL192539.1:2034826:2065614:-1 gene:ENSAMEG00000007335 transcript:ENSAMET00000008085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQC
WKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQI
GCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCL
PLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVN
NVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEM
SKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSG
YMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEEDD
DDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences G1LLD8
ENSAMEP00000007760 ENSAMEP00000007760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]