SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008239 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008239
Domain Number 1 Region: 414-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.94e-54
Family Eukaryotic proteases 0.00061
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 280-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000126
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000321
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008239   Gene: ENSAMEG00000007801   Transcript: ENSAMET00000008582
Sequence length 720
Comment pep:known_by_projection scaffold:ailMel1:GL192767.1:104123:174765:1 gene:ENSAMEG00000007801 transcript:ENSAMET00000008582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGIYCAECRAGW
YGGDCMRCGQVLRASKGQILLESYPLNSHCEWTIHAKPGFIIQLRFVMLSLEFDYMCQYD
YVEVRDGDSINSQIIRRFCGNERPAPIRSTGSSLHILFHSDGSKNFDGFHAIFEEITACT
SSPCFHDGTCLLDKTGSYKCACLAGYTGQRCENLLEESNCSDPGGPVNGYKKVTGGPGLI
NGHYAKIGTVVSFFCNNSYVLSGNERRTCQQNGEWSGKQPICIKACREPKTSDLVRRRVL
PMQVQSRETPLHQLYSASFSKQKLQGAPTKKPALPFGELPPGFQHLHTQLQYECISPFYR
RLGSSRRTCLRTGKWSGRAPSCVPICGKTENITAPKTQGLRWPWQAAIYRRASGMHGGSL
HKDTWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVVLGKFYRDDDRDEKTIQS
LRISAVILHPNYDPILLDTDIAILKLLDKARISTRVQPICLAAPRDLSTSFQESRITVAG
WNVLADVRSPGFKNDTLRSGGVRVVDALLCEEKHEDHGIPVSVTDNMFCAGRDPAAPSDI
CTAETGGIAAVSFPGRASPEPRWHLVGLVSWSYDKACSHSLYTAFSKVLPFKDWIERNMK
Download sequence
Identical sequences G1LMJ8
ENSAMEP00000008239 ENSAMEP00000008239 XP_002920662.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]