SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008780 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008780
Domain Number 1 Region: 53-240,386-592
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 5.75e-49
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0076
Further Details:      
 
Domain Number 2 Region: 718-971
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-46
Family YWTD domain 0.00000825
Further Details:      
 
Domain Number 3 Region: 1517-1702
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-30
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 1892-2065
Classification Level Classification E-value
Superfamily Fibronectin type III 8.93e-17
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 5 Region: 1374-1411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1153-1191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 7 Region: 1110-1151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000111
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 8 Region: 1281-1317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1327-1361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 10 Region: 1034-1074
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 1196-1229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 12 Region: 1428-1465
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 13 Region: 1707-1840
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000391
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number 14 Region: 1468-1507
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 1078-1111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 1233-1268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008780   Gene: ENSAMEG00000008234   Transcript: ENSAMET00000009155
Sequence length 2172
Comment pep:known_by_projection scaffold:ailMel1:GL192378.1:1965606:2113753:1 gene:ENSAMEG00000008234 transcript:ENSAMET00000009155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPXPLPQDRGFRVVQGEPREPGLWARGGPRGXKPLRRRRSAALQPEPIKVYGQVSLNDSH
NQMVVHWAGEKSNVIVALARDSLALARPRSSDVYVSYDYGKSFKRISEKLSFGVGNSSEA
VIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTIQGFSIPFRAADLLLHSKASNLLLGF
DRSHPNKQLWKSDDFGQTWILIQEHVKSFSWGIDIYDKPNTIYVERHEPSGYSTVFRSTD
FFQSRENQEVILEEVKDFQLRDKYMFATKVVHLWGIPQPSSVQLWVSFGRKPMRAAQFVT
RHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGGDTL
VRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYG
EKINCELAQGCSLHLAQRLSQLLSLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYI
SSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFIFSEKPVF
VYGLLTEPGEKSTVFTIFGSNKENVHNWLILQVNATDALGVPCTENDYKLWSPSDERGNE
CLLGHKTVFKRRTTHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLALEVCVPD
PEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVETRLEGELVPCPLAEENEFIL
YAMRKSIHRYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDTIQRLCLNGSTG
QEVIISSGLETVEALAFEPLSQLLYWVDSGFKKIEVANPDGDFRLTIVNSSVLDRPRALV
LLPQDGVMFWTDWGDLKPGIYRSNMDGTAVHCLVSEDVKWPNGISVDDQWIYWTDAYLDC
IERITFDGQQRSIILDNLPHPYAIAVFKNEIYWDDWSQLSIFRASKHSGSQMAVLASQLT
GLMDMKIFYKGKTMGSNACVSRPCSLLCLPRANNSRSCRCPDGVASSVLPSGDLMCECPQ
GYQRENNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTVCDLDTQ
FRCQESGTCIPLSYKCDLEDDCGDNSDETHCEMHQCRSDEYSCSSGMCIRSSWVCDGDND
CRDWSDEANCTAIYHTCEASNFQCRNGHCIPQRWACDGDMDCQDGSDEDPVNCEKKCNGF
RCPNGTCIPSSKHCDGLRDCSDGADEQHCEPLCTRFMDFVCKNHQQCLFHSMVCDGIVQC
RDGSDEDAAFAGCSQDPEFHKVCDEFSFQCQNGVCISLIWKCDGMDDCGDYSDEASCENP
TEAPNCSHYFQFQCDNGHCIPNRWKCDRENDCGDWSDERDCGDSHILPSPTPGPSTCLPN
YYRCSSGACVMDSWVCDGYRDCADGSDEEACPSPANVTTASVPTHHGRCDRFEFECHQPK
KCIPNWKRCDGHQDCQDGQDEANCPTHSTLTCMSTEFKCEDGEACIVLSERCDGFLDCSD
ESDERACSDELTVYKVQNLQWTADFSGDVTLTWTRPKKMPSAACVYNVYYRVVGEGIWKT
VETHSNKTNTILKVLKPDTTYQVKVQVQCLSKVHNTNDFVTLRTPEGLPDAPQNLQLSLR
REEEGVIVAHWIPPTHTHGLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNAPYTVR
VAAVTSRGVGNWSDSKSITTVKGKVIPPPDIHIDSYSENSLSFTLTVESDIKVNGYVVNL
FWAFDTHKQEKRTLNFRGSILSHKVANLTAHTSYEISAWAKTDLGDSPLAFEHVTTKGVR
PPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSRD
EQYLFLVRVVVPYQGPSSDYVVVRMIPDSRLPPRHLHAVHIGKTSAVIKWESPYDSPDQD
LLYAVAVKDLIRKSDRSYKIKTRNSTVEYTLSKLEPGGKYHIVVQLGNMSKDSSIKITTV
SLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNISAYLGNTTDNFF
KISNLKLGHNYTFTVQARCLFGSQICGEPAVLLYDELGSGGDASAFQAARSTDVAAVAVP
ILFLTLLSLGVGFAILYTKHRRLQNSFTAFANSHYSSRLGSAVFSSGDDLGEDDEDAPMI
TGFSDDVPMVIA
Download sequence
Identical sequences G1LP00
ENSAMEP00000008780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]