SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008783 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008783
Domain Number 1 Region: 59-246,392-598
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 5.49e-49
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0076
Further Details:      
 
Domain Number 2 Region: 724-977
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-46
Family YWTD domain 0.00000825
Further Details:      
 
Domain Number 3 Region: 1523-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-30
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 1898-2071
Classification Level Classification E-value
Superfamily Fibronectin type III 8.93e-17
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 5 Region: 1380-1417
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1159-1197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 7 Region: 1116-1157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000111
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 8 Region: 1287-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1333-1367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 10 Region: 1040-1080
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 1202-1235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 12 Region: 1434-1471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 13 Region: 1713-1846
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000369
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number 14 Region: 1474-1513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 1084-1117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 1239-1274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008783   Gene: ENSAMEG00000008234   Transcript: ENSAMET00000009158
Sequence length 2178
Comment pep:known_by_projection scaffold:ailMel1:GL192378.1:1965836:2113750:1 gene:ENSAMEG00000008234 transcript:ENSAMET00000009158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXPLPQDRGFRVVQGEPREPGLWARGGPRGGXXXXXXXKPLRRRRSAALQPEPIKVYGQV
SLNDSHNQMVVHWAGEKSNVIVALARDSLALARPRSSDVYVSYDYGKSFKRISEKLSFGV
GNSSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTIQGFSIPFRAADLLLHSKAS
NLLLGFDRSHPNKQLWKSDDFGQTWILIQEHVKSFSWGIDIYDKPNTIYVERHEPSGYST
VFRSTDFFQSRENQEVILEEVKDFQLRDKYMFATKVVHLWGIPQPSSVQLWVSFGRKPMR
AAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGG
AGGDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAP
AFTGYGEKINCELAQGCSLHLAQRLSQLLSLQLRRMPILSKESAPGLIIATGSVGKNLAS
KTNVYISSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFIF
SEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHNWLILQVNATDALGVPCTENDYKLWSPS
DERGNECLLGHKTVFKRRTTHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLAL
EVCVPDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVETRLEGELVPCPLAE
ENEFILYAMRKSIHRYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDTIQRLC
LNGSTGQEVIISSGLETVEALAFEPLSQLLYWVDSGFKKIEVANPDGDFRLTIVNSSVLD
RPRALVLLPQDGVMFWTDWGDLKPGIYRSNMDGTAVHCLVSEDVKWPNGISVDDQWIYWT
DAYLDCIERITFDGQQRSIILDNLPHPYAIAVFKNEIYWDDWSQLSIFRASKHSGSQMAV
LASQLTGLMDMKIFYKGKTMGSNACVSRPCSLLCLPRANNSRSCRCPDGVASSVLPSGDL
MCECPQGYQRENNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTV
CDLDTQFRCQESGTCIPLSYKCDLEDDCGDNSDETHCEMHQCRSDEYSCSSGMCIRSSWV
CDGDNDCRDWSDEANCTAIYHTCEASNFQCRNGHCIPQRWACDGDMDCQDGSDEDPVNCE
KKCNGFRCPNGTCIPSSKHCDGLRDCSDGADEQHCEPLCTRFMDFVCKNHQQCLFHSMVC
DGIVQCRDGSDEDAAFAGCSQDPEFHKVCDEFSFQCQNGVCISLIWKCDGMDDCGDYSDE
ASCENPTEAPNCSHYFQFQCDNGHCIPNRWKCDRENDCGDWSDERDCGDSHILPSPTPGP
STCLPNYYRCSSGACVMDSWVCDGYRDCADGSDEEACPSPANVTTASVPTHHGRCDRFEF
ECHQPKKCIPNWKRCDGHQDCQDGQDEANCPTHSTLTCMSTEFKCEDGEACIVLSERCDG
FLDCSDESDERACSDELTVYKVQNLQWTADFSGDVTLTWTRPKKMPSAACVYNVYYRVVG
EGIWKTVETHSNKTNTILKVLKPDTTYQVKVQVQCLSKVHNTNDFVTLRTPEGLPDAPQN
LQLSLRREEEGVIVAHWIPPTHTHGLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVN
APYTVRVAAVTSRGVGNWSDSKSITTVKGKVIPPPDIHIDSYSENSLSFTLTVESDIKVN
GYVVNLFWAFDTHKQEKRTLNFRGSILSHKVANLTAHTSYEISAWAKTDLGDSPLAFEHV
TTKGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKT
VIVSRDEQYLFLVRVVVPYQGPSSDYVVVRMIPDSRLPPRHLHAVHIGKTSAVIKWESPY
DSPDQDLLYAVAVKDLIRKSDRSYKIKTRNSTVEYTLSKLEPGGKYHIVVQLGNMSKDSS
IKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNISAYLGN
TTDNFFKISNLKLGHNYTFTVQARCLFGSQICGEPAVLLYDELGSGGDASAFQAARSTDV
AAVAVPILFLTLLSLGVGFAILYTKHRRLQNSFTAFANSHYSSRLGSAVFSSGDDLGEDD
EDAPMITGFSDDVPMVIA
Download sequence
Identical sequences G1LP03
ENSAMEP00000008783 ENSAMEP00000008783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]