SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008821 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008821
Domain Number 1 Region: 20-133
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000483
Family Kringle modules 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000008821
Domain Number - Region: 220-245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00248
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008821   Gene: ENSAMEG00000008379   Transcript: ENSAMET00000009198
Sequence length 375
Comment pep:known_by_projection scaffold:ailMel1:GL195173.1:28363:31566:1 gene:ENSAMEG00000008379 transcript:ENSAMET00000009198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRAPQGLRLLLLFLPLLPPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRE
DTAKLRAHHVCSKAGSQGKAVGWGLGFAAFGRNPDGDVQPWCYVAETEEGIYWRYCDIPT
CHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCVRFCRMKGYQLAGLEAGYACFCGSES
DLDRGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVVYSPDFPDE
YGPDRNPAPKGSAQTPAAPPDWANVSCSPRPGAPEAAAGARVFSTVTAISVLLLLLLSLL
RLLRRRSCLLAPGKGPPALGPSRGPGRSWAVWYRQPRGVALPCPPGDPQGEGLAASYRPL
SASSQSSLRSLISAL
Download sequence
Identical sequences G1LP41
ENSAMEP00000008821 ENSAMEP00000008821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]