SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008867 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008867
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-26
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 184-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008867   Gene: ENSAMEG00000008416   Transcript: ENSAMET00000009244
Sequence length 440
Comment pep:known_by_projection scaffold:ailMel1:GL192437.1:2399297:2438827:-1 gene:ENSAMEG00000008416 transcript:ENSAMET00000009244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGD
VSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGASKTSNKLTIQTCISF
CRSQRFKFAGMESGYACFCGNNPDYWKYGEAAGTECNSVCFGDHTQPCGGDGRIILFDTL
VGACGGNYSAMTSVVYSPDFPDTYATGRVCYWTIRVPGASRIHFSFTLFDIRDSADMVEL
LDGYTHRVLVRFSGRNRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEEPPQERP
TANQTLAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSSSQTPAKGWEPRGLRG
WTVYGLATLLILTVTAIVAKILLHITFKSHRVPAPGDLRDCHQPGTSGEIWSIFYKPSTS
ISIFKKKLKGQSQQDDRNPL
Download sequence
Identical sequences G1LP87
ENSAMEP00000008867 ENSAMEP00000008867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]