SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000009201 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000009201
Domain Number 1 Region: 114-341
Classification Level Classification E-value
Superfamily L domain-like 1.59e-50
Family Ngr ectodomain-like 0.0058
Further Details:      
 
Domain Number 2 Region: 408-721
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.03e-43
Family Rhodopsin-like 0.00054
Further Details:      
 
Domain Number 3 Region: 41-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000009201   Gene: ENSAMEG00000008702   Transcript: ENSAMET00000009597
Sequence length 754
Comment pep:known_by_projection scaffold:ailMel1:GL192400.1:473703:513768:-1 gene:ENSAMEG00000008702 transcript:ENSAMET00000009597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SICLILLAHAFTFLFPRVATLIFHMVLRKIKDFPLTEGSTITPLCQKGYFPCGNLTKCLP
RAFHCDGVDDCGNGADEDNCGDTSGWATIFGTVHGNANNVALTQECFLNQYPQPCGCKGT
ELECVNVGLKSVPVISSNTTLLSLKKNKIHSLPDKVFVKYTELKQIFLQHNCITHISRKA
FFGLHNLQILYLSHNCITTLRPGVFKDLHQLTWLILDDNPITRISQRLFTGLKSLFFLSM
VNNYLEALPTQMCAQMPQLNWMDLEGNGIKYLTNSTFLSCNSLTVLFLPRNQIDFVPEKT
FSSLKNLGELDLSSNMIMELPPHIFKDLKLLQKLNLSSNPLLYLHKNQFESLKQLQSLDL
ERIEIPNINTRMFQPMMNLSHIYFTNFRYCSYAPHVRICMPLTDGISSFEDLLANNILRI
FVWVIAFITCFGNLFVIGMRSFIKAENTTHATSIKILCCADCLMGVYLFFIGFFDIKYRG
QYQKYALLWMESLQCRFMGFLAMLSTEVSVLLLTYLTLEKFLVIVFPFSNIRPGKWQTSV
ILICIWIVGFLIAVIPFWNEDYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLL
AFLIIVFSYTIMFCSIKKTALQTSEVRNHIGREVAVANRFFFIVFSDAICWIPVFVIKIL
SLFRVEIPGTITSWIVIFFLPVNSALNPILYTLTTSFFKDKLKQLLHKHRRKSIFKTKKK
SLSTSIVWTDDSSSLKLGVLNKITLGDGTVKPMS
Download sequence
Identical sequences G1LQ71
ENSAMEP00000009201 ENSAMEP00000009201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]