SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010004 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010004
Domain Number 1 Region: 424-685
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.23e-76
Family Eukaryotic proteases 0.0000000312
Further Details:      
 
Domain Number 2 Region: 184-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-29
Family Spermadhesin, CUB domain 0.00000137
Further Details:      
 
Domain Number 3 Region: 28-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.00000124
Further Details:      
 
Domain Number 4 Region: 366-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0000121
Further Details:      
 
Domain Number 5 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000129
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 6 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000101
Family EGF-type module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010004   Gene: ENSAMEG00000009485   Transcript: ENSAMET00000010441
Sequence length 686
Comment pep:known_by_projection scaffold:ailMel1:GL192942.1:70291:85272:-1 gene:ENSAMEG00000009485 transcript:ENSAMET00000010441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFLKILGLAAGAPAATAPRPQWPEPVFGRLASPGFPGEYANNQEQRWTLTPPGYRLRLH
FTHFHLELSYLCEYDYVKLSSGTKVLATLCGHESTDTERAPGNDTFYSPASRLDVTFRSD
YSNEKPFTGFEAFYAAEDIDECQVPPGQAPPCDHHCHNHLGGFYCSCRRGYVLHGNRRTC
SALCSGQVFTNRSGVLSSPEYPQPYPKLSSCTYSIHLEEGFSIILDFVGSFDVETHPDTL
CPYDSLKIQTDKEEYGPFCGTTLPPRIETKSNAVTITFVTDHSGDHTGWKIHYTSTAQPC
PGPVAPPNGHIAPVQAEYILEDRFSVFCETGYELLQGYLPLKSFAAVCQRDGSWDQPMPK
CSIVDCGPPDDLPSGQVQYITGPDVTTYKAVIQYRCRETFYTMTPNDGKYVCEADGFWTS
SKGEKSLPVCEPVCGISTRTTGGRIYGGRNAKLGDFPWQVLLLGQTTAAGALLQDNWILT
AAHAVYTQKEAASSLDVRMGTLKRLSVHYTQAWAEAIFIHEGYTHGAGFDNDIALIKLKN
RVVINSNILPICLPGKEAESFMRTNDIGTASGWGLTQRGFLARNLMFVDIPIVDHQKCTA
AYEKQSYPGGRVTENMLCAGLEGGGKDSCRGDSGGALVFLDNDTQRWFVGGIVSWGSINC
GEANQYGVYTKVINYIPWIKNIINNF
Download sequence
Identical sequences G1LSG4
ENSAMEP00000010004 ENSAMEP00000010004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]