SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000010252 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000010252
Domain Number 1 Region: 145-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-35
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 30-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 262-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-34
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000010252   Gene: ENSAMEG00000009762   Transcript: ENSAMET00000010700
Sequence length 376
Comment pep:known_by_projection scaffold:ailMel1:GL192442.1:2170003:2177621:-1 gene:ENSAMEG00000009762 transcript:ENSAMET00000010700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAELGSCLLLAVALLGPGPRTHAMKGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLI
VVAEGSSVLLTFHAFDLEYHDSCGFDYLEVYNGASGDKGSLLGRFCGQVPPPPFTSSWHV
MSVVFHSDKHXXXXXXXXGFFADVCGGVLTGLSGVLTSPEYPDNYPNNVECRWVIRASGP
AIVKLVFVDFQVEGNEECTYDYVAVLGGPGPAREHHYCGSTRPPTLTSLGHELQVVFKSD
FNIGGRGFKAYFFSGECQEVYTAVRGNFSSPRYPSSYPNNVHCHWTIRLPPGYQVKVFFL
DLDLEGPNSLTRTCDFDHLAAFDGASEEAPLLGNWCGHHLPAPVTSSRNQLLLLLHTDRS
TTRRGFSVAYIGGQLG
Download sequence
Identical sequences G1LT56
ENSAMEP00000010252 ENSAMEP00000010252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]