SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011003 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011003
Domain Number 1 Region: 151-521
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.13e-90
Family Phosphonoacetate hydrolase 0.026
Further Details:      
 
Domain Number 2 Region: 617-856
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.77e-24
Family DNA/RNA non-specific endonuclease 0.01
Further Details:      
 
Domain Number 3 Region: 51-99
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000196
Family Somatomedin B domain 0.003
Further Details:      
 
Domain Number 4 Region: 100-140
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000562
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011003   Gene: ENSAMEG00000010324   Transcript: ENSAMET00000011474
Sequence length 875
Comment pep:known_by_projection scaffold:ailMel1:GL192988.1:82888:151133:1 gene:ENSAMEG00000010324 transcript:ENSAMET00000011474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESMRVLSTEEPVKRSSAKKYKIICIVLLALLVIVSLGLGLGLGLRRQEEQGSCRKNCFD
SSFRGLKSCRCDTGCKQRGDCCWDFEDTCVEPTRIWTCNRFRCGETRLESSLCSCSDDCL
QRKDCCADYKSVCQGETPWVKEECGTAQQSQCPEGFELPPVILFSMDGFRAEYLQTWDTL
IPNINKLKTCGIHSKYMRAVYPTKTFPNHYTIVTGLYPESHGIIDNNIYDVNLNRNFSLS
SKEKNNPAWWQGQPIWLTAMYQGLKAGSFFWPGSDVAINGSFPSMYMNYDRSIPYEERIS
TLLKWLDLPKAERPAFYTIYVEEPDSAGHNSGPVSGEVIQALQLVDKAFGMLMEGLKQRN
LHNCVNIILLTDHGMDQTYCDKVEYMTNYFPRINFYMYEGPAPRIRARNIPHDFYSFNSE
EIVRNLSCRKPDQHFKPYLTPDLPKRLHFAKNVRIDKAVLLVDRQWLAVRSKAYSCGGGN
HGYNNNFKSMEAIFLAHGSSFKEKTEIEPFENIEIYNLMCETDLLHIQPAPNNGTHGSLN
HLLKVPFYKPTHAEEVSKPSVCGFTVPLPPDDLDCSCPGLQNNASVQHVNQMLNLAQDAI
IATEKLNLPFGRPRVMQKNKEHCLLYHREYVSGFGKAIKMPIWSSYTVPKPGDTSPLPPT
VPDCLRADVRVAPSESQKCSFYLADENITHGFLYPPANNRTSDSQYDALITSNLVPMYKA
FKQMWDYFHSVLLVKHAMERNGVNVVSGPVFDYNYDGHFDAPNEITGYVKNTGVPIPTHY
FVVLTSCKNQNHTPDACPGWLDVLPFIIPHRPTNVESCPEGKPESVWIEERWQAHVARVR
DVELLTGLDFYQEKSQPVSEILQLKTYLPIFETII
Download sequence
Identical sequences G1LVA2
ENSAMEP00000011003 ENSAMEP00000011003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]