SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011037 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011037
Domain Number 1 Region: 1388-1504
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-36
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 2 Region: 929-1038
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 3152-3277
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-35
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 4 Region: 2686-2797
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-35
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 5 Region: 587-699
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-34
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 6 Region: 1167-1275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-34
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 7 Region: 1050-1156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-34
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 8 Region: 1736-1846
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 9 Region: 3399-3504
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 10 Region: 1623-1731
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-32
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 11 Region: 2225-2331
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-32
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 12 Region: 2334-2445
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 13 Region: 1507-1615
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-31
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 14 Region: 2449-2562
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-31
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 15 Region: 3034-3146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 16 Region: 3508-3619
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-29
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 17 Region: 1276-1385
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-29
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 18 Region: 1855-1962
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 19 Region: 821-925
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-28
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 20 Region: 1988-2087
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-27
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 21 Region: 2089-2210
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 22 Region: 472-583
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-25
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 23 Region: 2568-2684
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-25
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 24 Region: 2918-3032
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-24
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 25 Region: 706-811
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-24
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 26 Region: 2802-2915
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-21
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 27 Region: 3283-3389
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-19
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 28 Region: 130-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000594
Family EGF-type module 0.01
Further Details:      
 
Domain Number 29 Region: 430-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000615
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 30 Region: 262-398
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000738
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 31 Region: 390-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000181
Family EGF-type module 0.015
Further Details:      
 
Domain Number 32 Region: 181-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000262
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011037
Domain Number - Region: 211-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0401
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011037   Gene: ENSAMEG00000010368   Transcript: ENSAMET00000011510
Sequence length 3621
Comment pep:known_by_projection scaffold:ailMel1:GL192614.1:866367:1124261:-1 gene:ENSAMEG00000010368 transcript:ENSAMET00000011510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMSSSFLWGLVILLTFAESNGETGGLELQRQKRSTELQQARMAAERGNLVFLAGSAHNIE
FRTGSLGKIKLNEEDLGECLHQIQKNKDDITDLKRSAVGLPQNISSQVHQLNSKLVDLER
KFQSLQQTVDRKVCSSNPCQNGGTCLNLHDSFYCICPSQWKGPLCSVDVNECEIYSGTPL
GCQNGATCRNTAGSYSCLCSPETHGPQCASRYDDCDRGSKELCVHGICEDLVRVQAGQPK
YNCICEAGWTSPLNSSACVLDIDECSLQHAPCSALVQCFNTPGSFYCGACPTGWQGNGYS
CQDINECEINNGGCSVAPPVTCVNTLGSYHCQACPPGYQGDGRVCTLIDICSVNNGGCHP
DASCSSVLGSLPLCTCLPGYTGNGYGPNGCVQLSNICQSHPCLNGQCIETVSGYLCTCES
GWAGINCTENIKECLSNPCLNGGTCVDGVNAFSCECTRFWTGLLCQIPQQVCGGSLSGMS
GSFSYMSPDVGYVHDVNCFWVIRTEEGKVLRISFTFFRLESVSNCPHEFLQVHDGDSSAA
LQLGRFCGSILPHELLSSDNALYFHLHSEHFRNERGFTIRWETEQPECGGVLMGTYGSIK
SPGYPGNYPPGRDCVWKVVTSPGFLITFTFGTLSLEHHDDCSKDYLEIRDGPLYQDPVLG
KFCTTLSVPPLQTTGPFARIHFHSDNQINDQGFHVTYLTSPSDLHCGGNYTDPEGLLSSD
LSGPFIHNRQCVYIITQPLGEQIQVNFTHVELEGQSGCSQSYVEVRDDQTLLGKVCGSET
LSHIKSITNSIWIRLKIDASVVRASFRAVYQVACGGELTGEGVIRSPFYPNVYPGERICR
WTIHQPQSQVVILNFTAFEIKSSAHCDTDYIEIGSSSILGSPENKKYCGTDIPSFITSVY
NFLYVTFVKSSSTENRGFMAEFSSADLACGKILTESTGIIQSPGHPNIYPHGINCTWHIL
VQPGHLIHLTFRVFHLEFHYNCTNDYLEVYDTGSNTSLGRYCGKSIPPSLTSSTNSLMLV
FVADSDLAYEGFLINYGATDASAACIKDYTEESGTFTSPNFPGNYPNNWKCIYRITVETS
QQIALHFTNFSLEEAIGGHCIGDFVEIRDGGYERSPSLGTYCGSNPPPRIISHSNKLWLQ
FQSDFLDSGPGFSVTWDGSLTGCGGNLTTPTGVFTSPNYPMPYYHSSECYWWLKSSHGSP
FELEFEDFHLEYHPNCTSDYLAVYDGPSTSAHLLSQLCGNEKPPLIRSSGDSMFLKFRTD
EGQQGGGFLARYQQTCRNVVIVNQTYGILESIHYPGPYSDNQRCNWTIQATTGNTVNYTF
LAFELENHINCSTDYLELYDGSQRIGRYCGADMPLAGSTTGSKLQVLFYTDGVSHHEKGF
QMQWFIHGCGGELSGSTGSFSSPGYPNTYPPNKECIWYITTAPGSSIQLTIHDFDVEYHA
RCNFDVLEVYGGPDFHSPRIAQLCAQRSSENPMQVSSTGNELAIRFKTDSSINGRGFNAS
WQAVPGGCGGIFQAPNGEIHSPNYPSPYRRNTDCSWVIRVERNHRVLLNFTDFDLEPQDS
CITAYDGLSATTTRLSRVCGRQPLANPITSSGNSLFLRFQSGPSRQSRGFRAHFRQACGS
YILTNSFDTISSPLFPAMYPNNQNCSWIIQAQPPFNHITLSFDHFGLESSTTCTRDFIEV
LDGDHDDAPLRGRSCGTSMPHPITSFSSALTLRFVSDSTLNSEGFHATYAASSSACGGTF
HMAEGIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSQDCSRDFVEVREGN
ATGHLVGRYCGNVLPLNYSSIVGHILWIRFVSDGSGSGTGFQATFTKIFGNDNIVGTHGK
IASPLWPGRYPHNSNYQWVVNVNASQVIHGRILEMDIEAAHSCYYDKLRIYDGRGVHSRL
TGTYCGTQTATFSSSGNSLTFQFSSDSSITGKGFLLEWFAVNVSVGPLPTIATGACGGFL
RTGDAPVFLFSPGWPESYSNHVDCMWLIQAPDATVELNILSLDIEAHRTCDYDKLVIRDG
DSNLAPQLAALCGREIPGPIRSTGEYMFLRLTSDFSITGAGFNASFHKSCGGYLHADRGI
ITSPQYPETYSPNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCSQGDYLVLKNGPDIY
SPPLGLHGGNGHFCGSHPSSTLFTSDNQMFVQFISDGSNGGQGFKIKYEAKSLACGGNIY
IHDMDSAGYVTSPGHPDNYPQHADCTWLLAAPPGKLIRLQFEDQFNIEETPNCTSNYLEL
RDGADSNAPVLLKVCGRSLPSSQLSSGDVMYLRFRSDNSPTQVGFKFKYAIAHCGGRVTG
QSGVIESSGYPTLPYRDNLFCEWHLEGPSGHYLTIHFEDLNLQNSSGCEKDFVEIWESHT
SGSLLGRYCGNTIPDSIDTSSNIALVRFVTDGSLTASGFRLRFESSMEECGGDLQGPTGT
FTSPNYPNPNLHGRVCEWRITVQEGRRITLTFNNLSLEADPSCSSERVTILNGIRSNSPQ
LEELCSSVNVSDTIKSSGNTMKVVFFTDGSRPYGGFSASYTSSEDAVCGGPLTHSPEGNF
TSPGYNGVSNYSRNLNCEWTLSNPNQGNSSIYIHFEDFYLESHQDCQFDVLEFRVGNADG
PLMWRLCGPSKPTVPLVTPYPQVWIHFVTNERVEHVGFHAEYSFTDCGGIQLGENGVITS
PNYPASYDSLTHCSWLLEAPQGHTITLTFSDFDIEAHATCLWDSVTVRNGGSPGSPIIGQ
YCGSSNPRTIQSGSNQLVVIFNSDHSVQNGGFYATWNTQTLGCGGILHSGNGTIRSPHWP
QNFPENSRCSWTVITHESQQLEISFDNNFLIPSGDGQCQTSFVKVWAGTEEVDKTLLATS
CGNVAPASILTPRNAFTAVFQSQETPAQGFSASFVSRCGGNFTNPSGYILSPNYPKQYDN
NMNCTYVIEADPFSLVLLTFESFHLEDRSAVTGSCASDGVHIIRGSNFSSAPFATVCGDE
ILSPVTILGPVLLNFYSNEHNTDLGFKFNYEITSCGGVFNFSTGVIKSPAYSYSDYPNNI
QCSYTIIGRDDRVLQLKFSDFDVVPSTFCSQDYLAIYDGSDISDPLLGKFCGSELPPNIK
SSNHSLLLVFKTDSFETARGWKITFRETLGPRQGCGGYLTGSNNTFASPDSDFNGRYDKN
LNCVWFITAPVNKLIKLTFNTFSLEAQSILQRCIYDYVKLYDGDSENANLAGTFCGSTVP
APFISSGNFLTVQFVSDVTLEREGFNATYTIVDMPCGGTYNATWTPQSISSPNSSNPEIP
FSVCTWVLEAPPHQQVKITVWALQLPSQDCNQNYLEFQDSPESHANPGLLVCGRNASTAP
TFYSSGSTAIVTFKSEVLSRNSRVGFTYQIAGCNREYNKAFGSLKSPGWPDNYDNNLDCT
VILTAPQNHTISLFFHSFGIEDSSECTHDFLEVRNGSDSSSPLLGTYCGSLLPNPIFSQN
NQLHLRFQSDSATSSHGYEILWTSSPSGCGGTLYGDSGSFTSPGYPGTYPNNTHCEWAII
APAGRPVTVSFYFISIDDPGDCVQNYLILYDGPDANSPSSGPYCGADTNIAPFMASSHRV
FIKFHAEYAVRPSAFRLTWDS
Download sequence
Identical sequences G1LVD6
ENSAMEP00000011037 ENSAMEP00000011037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]