SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011068 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011068
Domain Number 1 Region: 126-507
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.64e-101
Family Phosphonoacetate hydrolase 0.017
Further Details:      
 
Domain Number 2 Region: 596-840
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 7.06e-24
Family DNA/RNA non-specific endonuclease 0.014
Further Details:      
 
Domain Number 3 Region: 35-80
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000955
Family Somatomedin B domain 0.0021
Further Details:      
 
Domain Number 4 Region: 81-122
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000732
Family Somatomedin B domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011068   Gene: ENSAMEG00000010477   Transcript: ENSAMET00000011541
Sequence length 855
Comment pep:known_by_projection scaffold:ailMel1:GL192988.1:209030:275555:1 gene:ENSAMEG00000010477 transcript:ENSAMET00000011541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNCRCDVACVDLG
NCCLDYQETCIEPERIWTCSKFRCGEKRLSRSLCSCSDDCRDKGDCCVNYGAVCRGEKSW
VEETCESINEPQCPAGFETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKNCGTYTKNMRP
AYPTKTFPNHYSIVTGLYPESHGIIDNKIYDPKMNAFFALKSKEKFNPEWYKGEPIWHTA
KYQGLKSGTFFWPGSDVEINGIFPDIYKIYNGSIPFEERILAILKWLQLPKDERPHFYTL
YLEEPDSSGHSYGPVSSEVIRALQRVDNMVGMLMDGLQELNLHRCLNLILISDHGMEQGN
CKKYVYLNKYLGDVKDIRIVYGPAARLRPSDVPDKYFSFDYEDLARNLSCREPNQHFKPY
LKHFLPKRLHFAKNDRIEPLTFYLDPQWQLALTPSERKDCGIGFHGSDNLLSNMQALFIG
YGPGFKHNTEVDAFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPVYTPKNPKEVHP
VVQCPSTRSPRRNLDCSCHPSVLPVVDFEIQLNLTVAEEKVIKRSTLPYGRPRVLQRNTS
ACLLYQHQFVSGYSHDFLMPLWTSYTVDRNDSFSAENFSNCLYQDLRISLSPVHKCSFYK
NNAELSYGFLYPPQLNKGSNQLYSEALLNTNIVPMYQSFQVIWRYFHGTLLPRYAEERNG
VNVVSGPVFDSDYDGCYDSSETLKQNSRLIRNQEILIPTHFFIVLTSCKNTFQTPSQCDD
LDSLAFILPHRTDNSESCANGKHESSWVEELLRLHRARIMDVEHITGLSFYQERKEPVSD
ILKLKTHLPTFNQED
Download sequence
Identical sequences G1LVG7
ENSAMEP00000011068 ENSAMEP00000011068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]