SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011090 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011090
Domain Number 1 Region: 412-519
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.28e-17
Family Mannose 6-phosphate receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011090
Domain Number - Region: 30-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000301
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 208-256
Classification Level Classification E-value
Superfamily EF-hand 0.000913
Family Calmodulin-like 0.073
Further Details:      
 
Domain Number - Region: 125-220
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00942
Family FCH domain 0.044
Further Details:      
 
Domain Number - Region: 361-406
Classification Level Classification E-value
Superfamily Tropomyosin 0.0196
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011090   Gene: ENSAMEG00000010502   Transcript: ENSAMET00000011564
Sequence length 534
Comment pep:known_by_projection scaffold:ailMel1:GL192824.1:26920:36930:-1 gene:ENSAMEG00000010502 transcript:ENSAMET00000011564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFALLLPLCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDHVNDDYCDCKDG
SDEPGTAACPNGSFHCTNTGYKPLYIASRWVNDGVCDCCDGTDEYNSGIVCENTCKEKGR
KERETLQQMAEVTREGFRLKKILIEDWKKAREEKQEKLAELQAGKKSLEDQVEMLRVVKE
EAEKPEKEAKDQHQKRWEEQQAATKAQREQELAANAFQELDDDMDGAVSVTELQTHPELD
SDGDGALSEAEAQALLGGDVQTDAAAFYDRVWAAIRDKYRSEVLPTSPPPAPSEPDLTEP
REEQPAVPPPPVEEEEEDEEGEETDEEEEEEEEDSQVQGEQPKVCVGGRDAPQPAPSPPE
EDKMPPYDEQTQAFIDAAQEARNKFEEAERSLRDMEESIRNLEQEISFDFGPNGEFAYSQ
CYELATNEYIYRLCPFKLVSQKPKLGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQG
PNRSTTVRLLCGKETVVTSTTEPSRCEYLMELMTPAACPEPPPEPPADGDHDEL
Download sequence
Identical sequences G1LVI9
ENSAMEP00000011090 ENSAMEP00000011090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]