SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011121 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011121
Domain Number 1 Region: 261-510
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.71e-82
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 165-266
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-19
Family Hepsin, N-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 128-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011121   Gene: ENSAMEG00000010563   Transcript: ENSAMET00000011595
Sequence length 514
Comment pep:known_by_projection scaffold:ailMel1:GL193353.1:69148:93287:-1 gene:ENSAMEG00000010563 transcript:ENSAMET00000011595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHLGRPTALPLPDAADKIRMALNSGSPPGDGPYYENHGYQPESLYPARPATVPSAYPVYP
APYYPPTVPQYTPRVPTHTSTPAVRVQPKSPLGTACTAKAKRALCITVALGAVLAGAAVA
AVLLWRFMESKCSVSGIECSSSGTCISPSQWCDGVLHCPSGEDENRCVRLYGPDFILQVY
SAQRKSWHPVCQDDWNDSYGRAACQDMGYRNSFYSSHGVMDDSGATSFMKLNITASNMDL
YKKLFHSDVCSSKMVVSLRCIECGVTAKMRRQSRIVGGSSASEGDWPWQVSLHVQGTHVC
GGSVITPEWIVTAAHCVEEPLNSPRYWTAFAGILRQSFMFYGHGYRVGKVISHPNYDSKT
KNNDIALMKLQTPLTFNGTDKVKPVCLPNPGLMLEPDQSCWISGWGATHEKGKTSDKLNA
AMVPLIEPQRCNSKYVYNNLVTPAMVCAGYLQGSVDSCQGDSGGPLVTLKSRIWWLIGDT
SWGSGCAKANRPGVYGNMTVFTDWIYRQMREADG
Download sequence
Identical sequences G1LVM0
ENSAMEP00000011121 ENSAMEP00000011121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]