SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011186 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011186
Domain Number 1 Region: 23-115
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-30
Family V set domains (antibody variable domain-like) 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011186   Gene: ENSAMEG00000010647   Transcript: ENSAMET00000011665
Sequence length 115
Comment pep:novel scaffold:ailMel1:GL193421.1:3776:4522:-1 gene:ENSAMEG00000010647 transcript:ENSAMET00000011665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFPAWFLGLLMFWIPGSSGEIEMTQTPLSLPITPGEPASVSCKASQSLLHSNGNTYLNW
YLQKPGLAPKRLIYMLPNRASGVPDRFSGSGSGKDFTLKISRVEADDAGVYYCQQ
Download sequence
Identical sequences G1LVT5
ENSAMEP00000011186 ENSAMEP00000011186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]