SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011519 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011519
Domain Number 1 Region: 298-582
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-46
Family Kelch motif 0.0049
Further Details:      
 
Domain Number 2 Region: 693-859
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-23
Family C-type lectin domain 0.0041
Further Details:      
 
Domain Number 3 Region: 64-186
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-22
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 4 Region: 999-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011519
Domain Number - Region: 35-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000597
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 185-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00701
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011519   Gene: ENSAMEG00000010900   Transcript: ENSAMET00000012010
Sequence length 1365
Comment pep:known_by_projection scaffold:ailMel1:GL192628.1:385406:530734:-1 gene:ENSAMEG00000010900 transcript:ENSAMET00000012010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPRPFLPLSAGLSLSPRKMVAAAATQARLSPAEAKECDRPCVNGGRCNPGTGQCVCPAGW
VGEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWD
HLYVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNIT
YNFDMCPNNCSGRGECKSSNSSNAVQCECLENWKGEACDIPHCIHDCGFPDRGVCNSSDV
RGCSCFPEWQGPGCSIPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYMFNHS
DYNMVLAYDLASREWLPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNELRVF
HIHNESWVLLTPKAKEQYAVVGHSAHIVTLKTGRVVMLVIFGHCPLYGYISNVQEYDLAK
NTWSILQTNGALVQGGYGHSSVYDHRTKALYVHGGYKAFSANKYRLADDLYRYDVDTQMW
TILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLP
RPDLHHDVNRFGHSAVLYNSTMYIFGGFNSLLLSDILVFTSERCEAHRSEAACLAAGPGI
RCVWDTGSSQCISWEVATEAQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCS
DHCVPVNHSCTEGQISISRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALP
ENICGIGWHLVGNSCLKITTAKENYDNAKLSCRNHNAFLASLTTQKKVEFVLKQLRIMQS
SQSMSKLTLTPWVGLRKINVSYWCWEDMSPFTNTLLQWMPSEPSDAGFCGILSEPSTRGL
KAATCINPLNGSVCERPANHSAKQCRTPCALRTACGECTSGSSECMWCSNMKQCVDSNAY
VASFPFGQCMEWYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGP
VKVPSQAPAGNSYPQPLLNASMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLT
TGKHCETCISGFYGDPTNGGRCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVEN
RYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFN
LNITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPI
KIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMA
SRPFASVNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPP
PGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences G1LWR6
ENSAMEP00000011519 ENSAMEP00000011519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]