SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011822 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011822
Domain Number 1 Region: 103-265
Classification Level Classification E-value
Superfamily C-type lectin-like 7.26e-19
Family C-type lectin domain 0.0063
Further Details:      
 
Domain Number 2 Region: 28-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011822
Domain Number - Region: 264-329
Classification Level Classification E-value
Superfamily FnI-like domain 0.000889
Family VWC domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011822   Gene: ENSAMEG00000011211   Transcript: ENSAMET00000012321
Sequence length 549
Comment pep:known_by_projection scaffold:ailMel1:GL192766.1:315990:372957:-1 gene:ENSAMEG00000011211 transcript:ENSAMET00000012321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPSCCLSTLWCVLLICSLSETCSTELRCNPGQFACRSGAIQCIPLPWQCDGWVTCEDES
DEADCPEVTGESRPYHGKEAVDPRPGRARGSDPKHFHAVNVAQPVRFSSFLGKCPTGWHH
YEGTASCYRVYLSGENYWDAAQTCQRVNGSLATFSTDQELRFVLAQEWDQPERSFAWQDQ
HKLWVGYQYVIASRNRSLEGRWEVAFKGSSEVFLPPDPIFASAMSESDNVFCAQLQCFHF
PTLRHHDLHSWHAENCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGG
EPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGNSLFDSMASGMRLIVSCISSFLIL
SLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDGEG
GTFHFHDPPPPYTAYKYPDIDQPDDPPPPYEASINPDSVFYDPADDDAFEPAEARPPTPG
DGSGDGASPRRLEHPLPAAGASLADLEDSADSSSALLVPPDPSQSGSTPATEALPGGGRH
SRSSLSTVV
Download sequence
Identical sequences G1LXL7
ENSAMEP00000011822 ENSAMEP00000011822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]