SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012786 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012786
Domain Number 1 Region: 227-269
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000051
Family Spermadhesin, CUB domain 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000012786
Domain Number - Region: 548-618
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0209
Family Spermadhesin, CUB domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012786   Gene: ENSAMEG00000012143   Transcript: ENSAMET00000013326
Sequence length 826
Comment pep:known_by_projection scaffold:ailMel1:GL192348.1:2916086:2943463:-1 gene:ENSAMEG00000012143 transcript:ENSAMET00000013326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVTAGQLLGMLRVAKSLLPSSGKAFEIAPPHGSGITVFIKPGSPALPAKLCYIINAKRHK
TSLTIQSGEKEVFSFSCHNPENHFVIEIQKTIDCMSGPCPFGEVQLQPPTSALPTLNRTF
IWDVKAHKSIGLELQFSIPRLRQIGPRESCPDGVTHSISGRIDATAVKIGTFCSNGTVSR
IKMQEGVKMALHLPWFHNRNVSGFSIANRSSIKRLCIIECVFEDEGSATLMSANYPDGFP
EDELMTWQFVIPPHLRASVSFLRFNVSNCEKKEERVEYYIPGSTTNPEVFRLEDKQPGNM
AGNFNLSLQGCDQDAQNPGILRLQFQVLVQHPQNESNKIYLVDLSNEQAMSLTIEPRPIK
LSRKFVPGCFVCLESRTCSNNLTLTSGSKHRISFLCDNLTRLWMNAEKTISCTDHRYCHR
RSYSLQVPGDILQLPVQLHDFSWKLLVPKGKLSLALVPSQKLRQHTQEKVCNTSFSYLVA
GAVPGQDLYFGSFCPGGSIEQIQVKQNISVTLRTFAPSFQQEASRQGLTVSFIPFFKEDG
VFTVTADTKSKVYLRTPNWDWGLPSLTSVSWNISVPSNQVACLTFLKERTGVVCQTGRAF
MIIQEQRSKAEEIFSLEDDVLPKPSFHHHSFWVNISNCSPVSGKQLDLFFWVLLTPRTMD
LTVIIIAVVGGGALLLFALGLIICFVKKKKKKKSKRPPVGIYNGNINTQMPMQPKKFQKG
RKDSDSHVYAVIDDTMVYGHLLQDSNGSFLQPEVDTYQPFQGPMGDYPPFPPPICSRAPT
AKLTTDEPPPAFPAESESEPYTFSHPNNGNTDVPLLDTHEPEDPGE
Download sequence
Identical sequences G1M0C6
ENSAMEP00000012786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]