SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012829 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012829
Domain Number 1 Region: 377-633
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3e-87
Family Eukaryotic proteases 0.0000000356
Further Details:      
 
Domain Number 2 Region: 134-244
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-27
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 3 Region: 1-113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-21
Family MAM domain 0.037
Further Details:      
 
Domain Number 4 Region: 285-386
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000876
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0098
Further Details:      
 
Domain Number 5 Region: 250-290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000157
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012829   Gene: ENSAMEG00000012189   Transcript: ENSAMET00000013371
Sequence length 634
Comment pep:known_by_projection scaffold:ailMel1:GL193732.1:413685:476418:1 gene:ENSAMEG00000012189 transcript:ENSAMET00000013371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGFYISTPTGPGGRQERVGLTSLPLDPTLEPVCLSFWYYMYGENVYKLSVNISSDQNVEK
TVFQKEGNYGENWNYGQVTLNETVEFKVAFNAFKNQILSDIALDDISLTHGICNVSLYPE
PTLVPTPPPELPTDCGGPFELWEPNTTFTSMNFPNSYPNQAFCVWNLNAQKGKNIQLHFQ
EFDLENIADVVEIRDGGGDDSLLLAVYTGPGPVKDVFSTTNRMTVLFITDKLLAKGGFKA
NFTTGYYLGIPVEPCKEDYFQCKNGECVPLVSLCDGLPHCTDGSDEAHCVRLFNGTMNSN
GLVQFRILSMWHVACADNWTTQISNDVCQLLGLGSGNSSTPIFSTGNGPFVKLNTDPTGS
LILTPSKQCFQDSLILLQCNHKSCGNKLVAREVSPKIVGGNNAQEGAWPWAVGLYYNGQL
LCGASLVSSDWLVSAAHCVYGRNLEPSKWEAILGLHMTSNLTSPQIVTRLIDQIVINPHY
NKRTKDSDIAMMHLDFKVNYTDYIQPICLPEENQVFPPGRICSIAGWGRVIYQGKSCPTA
NTLQEANVPLLSNEKCQQQMPEYNITENMVCAGYEEGGIDTCQGDSGGPLMCQENNRWFL
AGVTSFGYQCARPNRPGVYARVLRFTEWIQSFLQ
Download sequence
Identical sequences G1M0G9
ENSAMEP00000012829 ENSAMEP00000012829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]