SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013154 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013154
Domain Number 1 Region: 1191-1456
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-51
Family YWTD domain 0.0000023
Further Details:      
 
Domain Number 2 Region: 461-722
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-47
Family YWTD domain 0.00000588
Further Details:      
 
Domain Number 3 Region: 1811-2056
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-46
Family YWTD domain 0.0000162
Further Details:      
 
Domain Number 4 Region: 1506-1763
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-43
Family YWTD domain 0.0000219
Further Details:      
 
Domain Number 5 Region: 135-392
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-42
Family YWTD domain 0.0000706
Further Details:      
 
Domain Number 6 Region: 2946-3201
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-42
Family YWTD domain 0.0000216
Further Details:      
 
Domain Number 7 Region: 2120-2387
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-32
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 8 Region: 3822-4100
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-29
Family YWTD domain 0.0000933
Further Details:      
 
Domain Number 9 Region: 2857-2938,3194-3255
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.85e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1094-1183,1457-1501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000471
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 11 Region: 3688-3728
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 12 Region: 808-853
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000124
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 13 Region: 772-809
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 14 Region: 3562-3598
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 15 Region: 851-891
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 2821-2862
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 3483-3518
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 3283-3327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 2691-2726
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 896-934
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 935-971
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.00033
Further Details:      
 
Domain Number 22 Region: 2476-2517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 23 Region: 3405-3441
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 24 Region: 3604-3648
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 25 Region: 3523-3560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 26 Region: 2733-2767
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 983-1019
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00051
Further Details:      
 
Domain Number 28 Region: 3246-3281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 29 Region: 3440-3480
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 30 Region: 2611-2647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 31 Region: 3366-3402
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 2517-2556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000105
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 33 Region: 3325-3362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 34 Region: 1765-1815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000177
Family EGF-type module 0.014
Further Details:      
 
Domain Number 35 Region: 2650-2692
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 36 Region: 86-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 37 Region: 2769-2810
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000956
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 38 Region: 2570-2606
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 39 Region: 3730-3813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 40 Region: 2441-2478
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 41 Region: 1065-1101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000798
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 42 Region: 1029-1062
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000114
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 43 Region: 7-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000121
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 44 Region: 2075-2124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 45 Region: 3650-3682
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000367
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 46 Region: 411-447,717-766
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000738
Family Growth factor receptor domain 0.027
Further Details:      
 
Domain Number 47 Region: 4325-4359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.047
Further Details:      
 
Domain Number 48 Region: 55-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000013154
Domain Number - Region: 4219-4254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 4183-4217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000268
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 4146-4182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000424
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 4256-4288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013154   Gene: ENSAMEG00000012450   Transcript: ENSAMET00000013705
Sequence length 4451
Comment pep:known_by_projection scaffold:ailMel1:GL192456.1:683444:1828509:1 gene:ENSAMEG00000012450 transcript:ENSAMET00000013705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEEVEIKCPLNHVACLGANKCIHLSQLCNGVLDCSDGYDEGLHCQELLPNCQQLNCQYKC
AMVRNSTRCYCEDGFEVKEDGRSCRDQDECAIYGACSQTCINSYGSYACSCVEGYIMQPD
NRSCKAKNEPTDRLPMLLIANSETIEVFYLNGSKMATLSSVNGNEIHTLDFIYNEDMICW
IESRESSNQLKCIQITKTGRLTDEWAINILQSFHNVQQMAIDWLTRNLYFVDHVSDRIFV
CNYNGSVCVTLIDLELHNPKAIAVDPIAGKLFFTDYGNVAKVERCDMDGLNRTRIIDSKT
EQPAALALDLVNKLVYWVDLYLDYVEVVDYQGKNRHTIIQGRQVRHLYGITVFEDYLYAT
SSDNFNIIRINRFNGTDIHSLIKMENARGIRIYQKRTQPTVRSHACEVDPYGMPGGCSHI
CLLSSSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGIVRGMDLNTKIADEYM
IPIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTERETILKDDLDNVEGIAVDWI
GNNLYWTNDGHRKTINVARLEKASQSRKTLLEGEMSHPRGIVVDPVNGWMYWTDWEEDEI
DDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDAYYDHIEKVFLNGTHR
KIVYSGKELNHPFGLSHHGNYVFWTDYMNGSIFQLDLITNEVTLLRRERPPLFGLQIYDP
RKQQGDNMCRVNNGGCSTLCLAIPGGRVCACADNQLLDENGTTCTFNPGEILPHICKTGE
FRCKNRHCIQARWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCKNNRCIPKRWLCDGAN
DCGSNEDESNQTCSARTCQMDQFSCGNGRCIPRAWLCDREDDCGDQTDEMASCEFPTCEP
LTQFICKSGRCISSKWHCDSDDDCGDGSDEVGCVHSCLDNQFRCSSGRCIPGHWACDGDN
DCGDFSDEAQTNCTRQEIHSPAGCNGDEFQCHPDGNCIPDLWRCDGEKDCEDGSDEKGCN
GTLRLCDHKTKFSCRSTGRCINKAWICDGDIDCEDQSDEDDCDSFLCGPPKYPCANDTSA
CLQPEKLCNGRRDCPDGSDEGDLCDECSLNNGGCSNHCSVVPGRGIVCSCPQGLQLNKDN
KTCEIIDYCSNHLKCSQVCEQHKHTVKCSCYEGWKLDVDGESCTSVDPFEAFIIFSIRHE
IRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSESGGVSAVEVV
VEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHPRAIALDPRY
GILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIVWTDARSDAI
YSALYDGTAMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQNVSVIQKT
SAQPFDLQIYHPSRQPQAPNPCAANDGKGPCSHMCLINHNRSAACACPHLMKLSSDKKTC
YEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYWTDIKTQT
IKRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWVSSEFDETQINVARLDGSLKTSII
HGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPVGLSIDYVENKLYW
ISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQLGTCSKRDGR
NPTVLRNKTSGVVHMKVYDKEAQQGSNSCQLNNGGCSQLCLPTSETTRTCMCTVGYYLQK
NRMSCQGIESFLMYSVHEGIRGIPLEPSDKMDALMPISGTSFAVGIDFHAENDTIYWTDM
GFNKISRAKRDQTWKEDIITNGLGRVEGIAIDWIAGNIYWTDHGFNLIEVARLNGSFRYV
IISQGLDQPRSIAVHPEKGYLFWTEWGQMPCIGKARLDGSEKVILVSMGIAWPNGISIDY
EEHKLYWCDARTDKIERIDLETGGNREMVLSGSNVDMFSVAVFGAYIYWSDRAHANGSIR
RGHKNDATETITMRTGLGVNLKEVKIFNRVREKGTNVCAKDNGGCQQLCLYRGNSRRTCT
CAHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRPYENPHYFKNVIALAF
DYNQRRKGTNRIFYSDAHFGNIQLIKDNWEDRQVIVENVGSVEGLAYHRAWDTLYWTSST
TSSITRHTVDQTRPGAFDREAVIAMSEDDHPHVLALDECQNLMFWTNWNEQHPSIMRSTL
TGKNAQVVVSTDILTPNGLTIDHRAEKLYFSDGSLGKIERCEYDGSQRHVIVKSGPGTFL
SLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPMGIIAVANDTNSCELSPCS
LLNGGCHDLCLLTPNGRVNCSCRGDRILLDDNRCVTKNSSCNMYSEFECGNGECIDYQLT
CDGAPHCKDKSDEKLLYCENRSCRRGFKPCYNRRCIPHSKLCDGENDCGDNSDELDCKVS
TCAAVEFRCADGTCIPRSARCNQNIDCADASDEKSCNNTDCTHFYKLGVKTTGFIRCNST
SLCVLPSWICDGSNDCGDYSDELKCPVQNKHKCEENYFGCPSGRCILNTWICDGQKDCED
GLDEFHCDSSCSWNQFACSAQKCISKHWICDGEDDCGDGLDESDSICGAATCAADMFSCQ
GSHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTCDENAFMCHNKVCIPKQFVCDHDDD
CGDGSDESLQCGYRQCKAEEFSCADGRCLLNSQWQCDGDFDCPDHSDEAPLNPKCKSAEQ
SCNSSFFMCKNGRCIPSGGLCDNKDDCGDGSDERNCHINECLSKKVSGCSQDCQDLPVSY
KCKCWPGFQLKDDGKTCVDIDECSLGFPCSQQCINTYGTYKCLCTDGYEIQPDNPNGCKS
LSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIGIDFDYREEFIYWIDSSRPNGSR
INRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGLYPTILVSKRL
KFPRDLSLDPRAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMALTIDYVNQRLY
WADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSRAHKTSGADRL
SLINSWHAITDIQVYHSYRQPDVSKHLCMINNGGCSHLCLLAPGKTHTCACPTNFYLAAD
NRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQPGRFQCGTGLC
ALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNGQDDCGDEEDER
DCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPHEFQCRNNNCI
PDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDFDCADGSDERNC
ETSCSKGQFQCSNGQCISAKWKCDGHEDCKYGEDEKHCEPASPTCSSSEYICASRGCISA
SLKCNGEYDCADGSDEMDCVTECKEDQFRCRNKAHCIPIRWLCDGIHDCVDGSDEENCDR
GGNMCRADEFLCNNSLCKLHFWVCDGEDDCGDNSDEAPDMCAKFLCPPTRPYRCRNNRIC
LQPEQMCNGIDDCGDNSDEDHCGGKLTYKARPCKKDEFACSNKKCIPMDLQCDQFDDCGD
GSDEQGCRITSAEYTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQRNMKNRQCEDLNECL
VFGTCSHQCINIEGSYKCVCDQNFQERNNTCIAKGSEDQVLYIANDTDILGFIYPFNYSG
DHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKMIHGREKRQANSGLICPEFK
RPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNGPNCTRLLTNMAGEP
YAIAVNPKRGMMYWTVIGDHSHIEEAAMDGTLRRILVQKNLQRPTGLAVDHFSERIYWAD
LELSVIGSVLYDGSDSVISVSSKQGLLHPHRIDVFEDYIYGAGPKIGVFRVQKFGHGSVE
YLALDIDKTKGVLISHRYKQLDLPNPCLDLVCEFLCLLNPFGATCVCPEGKYLINGTCND
DSLLDDSCKLTCENGGRCILNEKGDLRCHCWPSYSGDRCEVNHCSNYCQNGGTCIPSALG
RPTCSCALGFTGPNCGKTVCEDFCHNGGTCSVTAGNQPYCHCQPDHTGDRCQYYVCHHYC
VNSESCTIGDDGSVECVCPTRYEGPKCEVDKCIRCHGGHCIINKDSEDIFCNCTNGKIAS
SCQLCDGYCYNGGTCQLDPETNVPVCLCSTNWSGTQCERPAPKSSKSDHINTRSIAIIVP
LVLLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPSYNMYEVGHDHSDGGL
LDPGFMVDATK
Download sequence
Identical sequences G1M1E3
ENSAMEP00000013154 ENSAMEP00000013154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]