SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013165 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013165
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-21
Family YWTD domain 0.00016
Further Details:      
 
Domain Number 2 Region: 256-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000798
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 3 Region: 299-339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000123
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 221-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 5 Region: 391-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 429-462
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.00033
Further Details:      
 
Domain Number 7 Region: 142-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013165   Gene: ENSAMEG00000012450   Transcript: ENSAMET00000013719
Sequence length 462
Comment pep:known_by_projection scaffold:ailMel1:GL192456.1:1112850:1169507:1 gene:ENSAMEG00000012450 transcript:ENSAMET00000013719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WMYWTDWEEDEIDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDAYYD
HIEKVFLNGTHRKIVYSGKELNHPFGLSHHGNYVFWTDYMNGSIFQLDLITNEVTLLRRE
RPPLFGLQIYDPRKQQVSDNMCRVNNGGCSTLCLAIPGGRVCACADNQLLDENGTTCTCK
FCLFIDFLCIYGMQLAQVSFKCNGKYHEECYDSFNPGEILPHICKTGEFRCKNRHCIQAR
WKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCKNNRCIPKRWLCDGANDCGSNEDESNQT
CSARTCQMDQFSCGNGRCIPRAWLCDREDDCGDQTDEMASCVTCISDCHYILKFMNFSIG
TQFSCQKNACVCNNLMECCDNPRSYSVEFPTCEPLTQFICKSGRCISSKWHCDSDDDCGD
GSDEVGCVHSCLDNQFRCSSGRCIPGHWACDGDNDCGDFSDE
Download sequence
Identical sequences G1M1F4
ENSAMEP00000013165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]