SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013167 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013167
Domain Number 1 Region: 750-1005
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-43
Family YWTD domain 0.0000216
Further Details:      
 
Domain Number 2 Region: 3-190
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-28
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 3 Region: 661-742,998-1061
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 1367-1404
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000785
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 5 Region: 625-666
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1211-1247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 7 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 1089-1133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 495-530
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 1329-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 537-571
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 1051-1086
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 415-451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 285-322
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 15 Region: 1246-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 16 Region: 1172-1208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 1131-1168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 18 Region: 454-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 19 Region: 324-361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 573-614
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 21 Region: 374-410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 22 Region: 244-281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000114
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000013167
Domain Number - Region: 198-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013167   Gene: ENSAMEG00000012450   Transcript: ENSAMET00000013721
Sequence length 1411
Comment pep:known_by_projection scaffold:ailMel1:GL192456.1:1509096:1703282:1 gene:ENSAMEG00000012450 transcript:ENSAMET00000013721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVGSVEGLAYHRAWDTLYWTSSTTSSITRHTVDQTRPGAFDREAVIAMSEDDHPHVLALD
ECQNLMFWTNWNEQHPSIMRSTLTGKNAQVVVSTDILTPNGLTIDHRAEKLYFSDGSLGK
IERCEYDGSQRHVIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDI
PHQPMGIIAVANDTNSCELSPCSLLNGGCHDLCLLTPNGRVNCSCRGDRILLDDNRCVTK
NSSCNMYSEFECGNGECIDYQLTCDGAPHCKDKSDEKLLYCEENRSCRRGFKPCYNRRCI
PHSKLCDGENDCGDNSDELDCKVSTCAAVEFRCADGTCIPRSARCNQNIDCADASDEKSC
NNTDCTHFYKLGVKTTGFIRCNSTSLCVLPSWICDGSNDCGDYSDELKCPVQNKHKCEEN
YFGCPSGRCILNTWICDGQKDCEDGLDEFHCDSSCSWNQFACSAQKCISKHWICDGEDDC
GDGLDESDSICGAATCAADMFSCQGSHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTC
DENAFMCHNKVCIPKQFVCDHDDDCGDGSDESLQCGYRQCKAEEFSCADGRCLLNSQWQC
DGDFDCPDHSDEAPLNPKCKSAEQSCNSSFFMCKNGRCIPSGGLCDNKDDCGDGSDERNC
HINECLSKKVSGCSQDCQDLPVSYKCKCWPGFQLKDDGKTCVDIDECSLGFPCSQQCINT
YGTYKCLCTDGYEIQPDNPNGCKSLSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNV
IGIDFDYREEFIYWIDSSRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSD
TEKRIIEVSKLNGLYPTILVSKRLKFPRDLSLDPRAGYLYWIDCCEYPHIGRVGMDGTNQ
SVVIETKISRPMALTIDYVNQRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFED
YIYWTDGKTKSLSRAHKTSGADRLSLINSWHAITDIQVYHSYRQPDAVVSKHLCMINNGG
CSHLCLLAPGKTHTCACPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCG
DGSDEPDDCPEFKCQPGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKC
TKNQKCIPVNLRCNGQDDCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCA
DASDEANCDKKTCGPHEFQCRNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCA
NGDCVSSRFWCDGDFDCADGSDERNCETSCSKGQFQCSNGQCISAKWKCDGHEDCKYGED
EKHCEPASPTCSSSEYICASRGCISASLKCNGEYDCADGSDEMDCVTECKEDQFRCRNKA
HCIPIRWLCDGIHDCVDGSDEENCDRGKNIC
Download sequence
Identical sequences G1M1F6
ENSAMEP00000013167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]