SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013290 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013290
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily SRP19 9.29e-40
Family SRP19 0.000000612
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013290   Gene: ENSAMEG00000012623   Transcript: ENSAMET00000013847
Sequence length 146
Comment pep:novel scaffold:ailMel1:GL192656.1:247800:253406:-1 gene:ENSAMEG00000012623 transcript:ENSAMET00000013847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKMACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGL
NVFLEKNKMYSREWNRDVQYRGRVRVQLKQDDGSLCLVQFPSRKSVMLYVAEMIPKLKTR
TQKTGGGDQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences G1M1S9
ENSAMEP00000013290 ENSAMEP00000013290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]