SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013414 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013414
Domain Number 1 Region: 282-402
Classification Level Classification E-value
Superfamily TIMP-like 4.08e-36
Family Netrin-like domain (NTR/C345C module) 0.00021
Further Details:      
 
Domain Number 2 Region: 96-209
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 2-83
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-21
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013414   Gene: ENSAMEG00000012725   Transcript: ENSAMET00000013973
Sequence length 402
Comment pep:known_by_projection scaffold:ailMel1:GL192498.1:951581:978483:-1 gene:ENSAMEG00000012725 transcript:ENSAMET00000013973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLQVPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHTNGQRIGRFCGTFRPGALVSSGN
KMMVQMISDANTAGNGFMAMFSAAEPNLKNSGDQYCGGRLERPSGSFKTPNWPDRDYPAG
VTCVWHIVAPKNQLIELKFEKFDVERDNYCRYDFVAVFNGGEVNDAKRIGKYCGDSPPAP
IVSERNELLIQFLSDLSLTADGFIGHYKFRPKKLPTTTAPPVTTTFPATTGERKNESRPD
RSTGTSRKLLCLTSPLQAPLHTHRADQVSHLNSNLGVKPTVALCQQKCRRTGTLESNYCS
SNFVLAGTVITTVTRGGSLHATVSIINIYKEGNLAIQQAGKNMSAKVTVVCKQCPLLRRG
LNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLDALKNKQC
Download sequence
Identical sequences G1M253
ENSAMEP00000013414 ENSAMEP00000013414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]