SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013712 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013712
Domain Number 1 Region: 134-246
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-38
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 3.77e-37
Family Link domain 0.00000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013712   Gene: ENSAMEG00000013023   Transcript: ENSAMET00000014283
Sequence length 277
Comment pep:novel scaffold:ailMel1:GL193011.1:17618:32588:-1 gene:ENSAMEG00000013023 transcript:ENSAMET00000014283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILTYLFVLLWEEAHGWGFKNGIFHNSIWLEQAAGVYHREARSGKYKLTYAEAKAVCEY
EGGQLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYDDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPACLADYVEIYDSYDDVHGFVGRFCGDELPEDIVSTGNVMTLKFLSDASVTAGGF
QIKYVALDPLSKSSQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences D2HLK3
XP_002923271.1.58354 ENSAMEP00000013712 ENSAMEP00000013712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]