SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014280 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014280
Domain Number 1 Region: 232-487
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.86e-63
Family Eukaryotic proteases 0.000000189
Further Details:      
 
Domain Number 2 Region: 51-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-23
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 193-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000344
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014280   Gene: ENSAMEG00000013559   Transcript: ENSAMET00000014879
Sequence length 491
Comment pep:known_by_projection scaffold:ailMel1:GL192900.1:399126:409861:1 gene:ENSAMEG00000013559 transcript:ENSAMET00000014879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSRCLVSEWGNDHWRSPHSTSCPGKMWWLLLWGVLQACPTQGSVLLAKELPQQLTSPG
YPEPYLKGQESSTDIEAPEGFAVRLVFQHFDLEPSQDCEQDSVTITASGMDPSRFCGQQG
SPLGSPPGQREFVSPGNRLRLTFRAPASSQDGTTGLHKGFLALYQAVGVTHRRPIGQARG
ASEATSVPGDHPSKIQNPCQEPYYQAAPTGTLTCTPQGPWKGPQDGEELPRCVPVCGRPV
TAIDQNQEALGSSRAKLGNFPWQAFTNIYGRGGGALLGDRWVLTAAHTIYPKDGIFLGRN
RSVDVFLGHTSIDEMLRLGSHPVRRVVVHPDYRQHESHNFDGDIALLELQSAVPLGPSLL
PVCLPERQALYRSGVWGYVSGFGVDRGWLTTELKYSRLPVAPRAACRAWLLEKQRSEVFS
ANMFCAGDKMRQQSVCQGDSGGVYVVWDERAHHWVATGIVSWGVGCGKGYGFYTKVLNYR
DWIRGVMDGKD
Download sequence
Identical sequences G1M4L3
ENSAMEP00000014280 XP_011227004.1.58354 ENSAMEP00000014280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]