SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014288 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014288
Domain Number 1 Region: 20-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-25
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 2 Region: 215-321
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.08e-19
Family Platelet-derived growth factor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014288   Gene: ENSAMEG00000013560   Transcript: ENSAMET00000014887
Sequence length 329
Comment pep:novel scaffold:ailMel1:GL193785.1:305202:382196:-1 gene:ENSAMEG00000013560 transcript:ENSAMET00000014887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESNHLTDLYRRDETVQVTGSGHLQSPRFPSSYPRNLLLTWRLRSRENTRIQLAFDHRFGL
EEAENDICRYDFVEVEDISETSTVIRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKP
GFKIYYSFVEDFQPAAASETNWESVTSSISGVSYHSPSVTDPTLTADALDKTVAEFDTVE
DLLKHFNPESWQEDLENLYLETPHYRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNL
REELKLTHVVFFPRCLLVQRCGGNCGCGTISWKSCMCSSGKTVKKYHEVLKFEPGHFKRR
GRAKHMALVDIQLDHHERCDCICSSRPPR
Download sequence
Identical sequences D2HZ88
ENSAMEP00000014288 ENSAMEP00000014288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]