SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014308 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014308
Domain Number 1 Region: 135-249
Classification Level Classification E-value
Superfamily EndoU-like 9.02e-27
Family Eukaryotic EndoU ribonuclease 0.00078
Further Details:      
 
Domain Number 2 Region: 87-126
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000314
Family Somatomedin B domain 0.0024
Further Details:      
 
Domain Number 3 Region: 21-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000157
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014308   Gene: ENSAMEG00000013582   Transcript: ENSAMET00000014908
Sequence length 250
Comment pep:known_by_projection scaffold:ailMel1:GL192744.1:1024827:1033633:-1 gene:ENSAMEG00000013582 transcript:ENSAMET00000014908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACVPLIVAILCSLAWAGKLESCASRCNEKFHRDAACQCDHQCPRHGDCCEDSEHLCTG
APSARSDLGSALDTPLPVLLDLYTAPSSCRYRCHEAFDRHQPCHCNARCPEFGNCCKDFE
SLCGHEGFSYSRDAITKEGLQSISEKIYRADINKAQKEDIILNSQNRILPSETRDQVDRC
PEPLFTYVNEKLFSKPTYAAFISLLNNYQRATGRGEHFDGQQLAEQDAFLREVMKTAVMK
ELYGFLRHQS
Download sequence
Identical sequences G1M4P1
ENSAMEP00000014308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]