SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014391 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014391
Domain Number 1 Region: 447-701
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.6e-70
Family Eukaryotic proteases 0.0000000083
Further Details:      
 
Domain Number 2 Region: 23-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-29
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 3 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-28
Family Spermadhesin, CUB domain 0.0000387
Further Details:      
 
Domain Number 4 Region: 308-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000431
Family Complement control module/SCR domain 0.0000216
Further Details:      
 
Domain Number 5 Region: 376-456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000598
Family Complement control module/SCR domain 0.0000347
Further Details:      
 
Domain Number 6 Region: 141-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000641
Family EGF-type module 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014391   Gene: ENSAMEG00000013566   Transcript: ENSAMET00000014993
Sequence length 705
Comment pep:known_by_projection scaffold:ailMel1:GL192900.1:414397:421849:1 gene:ENSAMEG00000013566 transcript:ENSAMET00000014993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWLLYLLVPILFCRVGGSIPISQKLFGEVTSPLYPKPYPSNFEKTTVITVPTGFRVKLIF
WQFDLEPSEGCLYDYVKISADKKTLGRFCGQLGSPLGNPPEAKEFMSQGNKMLLTFHTDF
SNEENGTVMFYKGFLAYYQAVDLDECASQRNSVEENLQPQCQHLCHNYVGGYFCSCRPGY
ELQKDGHSCQAECSSELYTEPSGYITSLEYPRPYPPDLRCNYSIRVERGLTLHLKFLEPF
EIDDHQQVHCPYDQLQIYASGRNIGEFCGKQRPADFDSNSNAVDLLFFTDESGDSRGWKL
HYTTEIIKCPQPQTLDKFTIIQDLQPQYQFRDYFIVTCQPGYQLVEGNQVLLSFTAVCQD
DGTWHRAMPRCKIKDCGPPRSLANGAFNYITTKGVNTYQSRIQYYCQEPYYKMHTRGGIS
ETARGAYTCTAEGVWKNEWEGSKVPRCLPVCGKPVHPVEQKQRIIGGQKAKLGNFPWQAF
TNIYGRGGGALLGDRWILTAAHTLYPKDHDAQSNATVDVFLGHVSVEEITKLANHPVRRV
SIHPDYRQDESHNFEGDIALLELENSVTLGPNLLPICLPDNETFYDRGLMGYVSGFGIME
ERLSYDLKFIRLPVAKREACESWLRKNKRNDVFSQNMFCAGDPSLKQDACQGDSGGVFAV
KDENNDRWVATGIVSWGIGCSKGYGFYTKLLNYVDWIKKEMEGEG
Download sequence
Identical sequences G1M4X4
ENSAMEP00000014391 ENSAMEP00000014391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]