SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014598 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014598
Domain Number 1 Region: 31-72
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000105
Family Somatomedin B domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014598   Gene: ENSAMEG00000013847   Transcript: ENSAMET00000015204
Sequence length 750
Comment pep:known_by_projection scaffold:ailMel1:GL193215.1:507445:513696:1 gene:ENSAMEG00000013847 transcript:ENSAMET00000015204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPPKPPGSWEVPAAWEGGGPGPAEGSGARGSCSHRCGDRDELCSCHPTCFGLSTCCSDF
RDFCLEVSPYSGSMMGGKDFVVQHLNWFNPTDGVICRFKESIQTLGHVDSSGHVHCVSPL
LYETGRIPFTLSMDNGRSFPRSGTWLAVHPNKVSKTEKSELVNETRWQYYGTAGITGNLS
LTWEPSALSTQFVTIELWGYEETGKPYSDKWAAKWSYLYPLATSIPNSGFFTFTPKPAPQ
NYQRWEVGALRIVNSKYYAGEKDVHAVWSNEHALAWHLGEDFQADPEAWARAQCLAWEEL
EDQLPNFLEELPDCPCTLAQARADSGRFHTDYGCDIEHGSVCTYHPGAVHCVRSVQASPR
YASGQQCCYTEAGTLLLTADSTGGSTPDRGHDWGAPPFRTPPRVPGLSHWLYDVVSFYHC
CLWAPECSRYMRRRPSSDCRSYRPSRLASAFGDPHFVTFDGANFSFNGRGEYVLLEATLT
NLRVQGRAQPRTTSDGTQDRGTGLTAVAVQEGNSDVLEVRLAGGEGVLQVLLNQEVLSFT
EQSWMDLKGMFLSVAAEDSISIMLSSGAGLEVSVQGPFLSVTVLLPEKFLTHTQGLLGTL
NNDPTDDFTLRNGKVLPSKAASRELFRFGADWAVENASSLLTYDSWFLVNNFLYQSKHDH
TFQPLFPEETIPNPSLAAEAAEVCGDNQFCTFDVMATGSLRVGNATRTAHQWHQHRVQSL
QPVTSCGWLAPPPNGRKEGIGYLSGSTVYF
Download sequence
Identical sequences G1M5I0
ENSAMEP00000014598 ENSAMEP00000014598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]