SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015027 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015027
Domain Number 1 Region: 79-164
Classification Level Classification E-value
Superfamily HMG-box 2.49e-31
Family HMG-box 0.00000617
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 3.53e-27
Family HMG-box 0.00000728
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000015027
Domain Number - Region: 182-209
Classification Level Classification E-value
Superfamily ARM repeat 0.0748
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015027   Gene: ENSAMEG00000014262   Transcript: ENSAMET00000015645
Sequence length 210
Comment pep:novel scaffold:ailMel1:GL192346.1:5001896:5003472:1 gene:ENSAMEG00000014262 transcript:ENSAMET00000015645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKF
EDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGL
SIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTG
SKKKNEPEDEEEEEEEEEDEDDEEEEEDEE
Download sequence
Identical sequences D2GUW1 E2QY30 M3W1S7 M3XS53
9615.ENSCAFP00000011606 9685.ENSFCAP00000003886 ENSMPUP00000001903 ENSMPUP00000001903 ENSAMEP00000015027 ENSCAFP00000011606 ENSFCAP00000003886 ENSCAFP00000011606 ENSAMEP00000015027 XP_002912713.1.58354 XP_003984907.1.62641 XP_004395292.1.74151 XP_004395293.1.74151 XP_004766160.1.14098 XP_006737676.1.47382 XP_006737677.1.47382 XP_006737678.1.47382 XP_006930835.1.62641 XP_007097212.1.5354 XP_008703273.1.72690 XP_008703274.1.72690 XP_012416050.1.74151 XP_019296539.1.44245 XP_019296540.1.44245 XP_019652200.1.58354 XP_021554487.1.83697 XP_021554488.1.83697 XP_543194.2.84170 ENSFCAP00000003886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]