SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015037 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015037
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-22
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.68e-20
Family Platelet-derived growth factor-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015037   Gene: ENSAMEG00000014266   Transcript: ENSAMET00000015655
Sequence length 345
Comment pep:known_by_projection scaffold:ailMel1:GL192663.1:963691:1161634:1 gene:ENSAMEG00000014266 transcript:ENSAMET00000015655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFGLLLLTSALAGQRHGTQAESNLSSKFQYSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNMVLVWRLVAAEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVVPQFTEAVSPSMLPPSA
LPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKSGVRGLHKSLTDVALEHHEECDCVCRGHTGG
Download sequence
Identical sequences G1M6R7
ENSAMEP00000015037 ENSAMEP00000015037 XP_002919318.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]