SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015174 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015174
Domain Number 1 Region: 166-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015174   Gene: ENSAMEG00000014402   Transcript: ENSAMET00000015797
Sequence length 266
Comment pep:known_by_projection scaffold:ailMel1:GL192679.1:456930:464852:1 gene:ENSAMEG00000014402 transcript:ENSAMET00000015797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQMLLLLGAAALAASALETADLVDLCGQTWQGAGLLLRSHAASRRFYFATPDTDCGLWMR
AAAAGDRIRFQFRFFLVYSLAAAARAPSGSPAPNASSPEPADPCAPGSYLQFYEGPPGAP
RPRGPLXXXXXXXXXXXXXPLRLLTRGRQPRVDFVGEATSFRLGACGAYFRCQNGRCIPP
SLVCDRWGVDNCGDGSDLASWPPADCRAGPSLVPSQAGSTDGPASKPLTRSPALRSAETL
QMAAQKTLLAGRAPEQQDAAAPLGGR
Download sequence
Identical sequences G1M754
ENSAMEP00000015174 ENSAMEP00000015174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]