SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015258 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015258
Domain Number 1 Region: 184-360
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-34
Family APC10-like 0.0026
Further Details:      
 
Domain Number 2 Region: 1798-1858
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000004
Family ZZ domain 0.0077
Further Details:      
 
Domain Number 3 Region: 1756-1807
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000388
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 70-138
Classification Level Classification E-value
Superfamily EF-hand 0.00000303
Family Polcalcin 0.071
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000015258
Domain Number - Region: 1097-1171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00157
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015258   Gene: ENSAMEG00000014465   Transcript: ENSAMET00000015889
Sequence length 1975
Comment pep:known_by_projection scaffold:ailMel1:GL193983.1:282527:357708:1 gene:ENSAMEG00000014465 transcript:ENSAMET00000015889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPRAVWSSGQGPNMGPPVSAPALGRAGAQRPVEGCTQXXXXXXXAPPCESLVSRHHGALL
RWLEERLGRGEESVTLEQFRELLEARGAGCSGEQFEEAFAQFDAEGDGTVDAENMLEALR
NSSGANLQGELSHIIRQLQACSLVPGFIDIFSECKEGVGVHASLILRFLHRNRLSGAAVP
CPMLDRCGNVCSMRSSVLKESLDQLLQREKESPGDLTRSPEMDKLKSVAKCYAYIETSSN
PADIDKMTNGETSSYWQSDGSARSHWIRLKMKPDVVLRHLSIAVASTDQSYMPQQVTVAV
GRSASDLQDVRDVHIPSNVTGYVTLLENANISQHYVQVNIKRCLSDGCDTRIHGLRAVGF
QRVKKSGLSVSDASAIWYWSLLTSLVTASMETNPAFVQTVLHNTQKALQHMPPLSLSPGS
TDFSTFLSPSVLEEVDSFLIRITSCCSTPEVELTLLAFALARGSVARVLDSLCTVTDRLD
AQYDASSLISSMASVRQSLLLKYGKPLQLTLQACDVKGKEEKSGPENLLVEPWTRDGFLT
ETGKTRASTIFSTGTESAFQVTQIRIMVRRGGIGAQCGLVFAYNSSSDKFHAEEHFKRFE
KYDKWKLQEFRQFVKSRVGCSADGLGEDDPVGWFELEEEWDEADVKVQQCRVAKYLMVKF
LCTRQESAERLGVQGLSISGYLRPLRADAELHVVCAHCRRDGDDSVCGATLLLKTLQFIQ
QLAHDLVQQKESGIKYKSFLDFAGLDLQIFWNFYSKLKQNPREECVWAQTLLLRLLQSCL
PVLQRDGPAASEETKPPRQSPGGAAAAKELHTHLCDVVDRVDGDSAPMETLKQEVRNTLL
NGAAVFFPDRQTRRSRLFAMMNVTEQERKQSLQLTFHSLCTYFSDKDPGGLLLLPEKGDV
ADMNSSEVLAGMSTLLSVAARECEMLVLTGAQGEAGSVLFSLFWAVQGSLLSWCYLQLKS
TDSAARGRAADLIDQYVRQVLARMRVILESLLSQYSGKTIVEKLCNSVFSMAARQLVIFL
LDFCTLDISHCTLLREFSTLIELLRQLCADLEGTPNKLDGETWQQESPVVLHTWTKESAH
NYENNCHDVSVFVSPGATYFEVEFDERCETEKRYDYLEFTDARGGKTRYDTKVGTEKWPK
KVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAVSWALDLQLLVSRLMGRLAAQC
MALKSAHQFGSDMAVPPAKMASVLNSPLWKPVFRHQLSPELGFAASWPTPPRQDSKEVKD
IPDDPCHHFLLEFAQSDPAQTFCGPFSELFKGFIQACRKQAPKTDIVAGSTIDRAVNAAF
AALVCRTPGLYEKLQTHVKSGGSTALSEEFAQVYCLADGIRIWMLEMKQKSLMNMGTEKE
EKHGSGAAEVNPESLAKECIQKSLLLLRFSPVGVSSKESRDRLAGADDTDHLQSQDKRPR
TSSVLEEHFQASVSPGEAGAPAAGNGGPGSDTRLKLPPGSSPPATELSSATTEEPSSPSA
PARRPPFTRGRLRLLSFRSMEEARPAPTVKEKYPVLKDVLDFIKDQSLSHESVVKVLALR
KAQAQSVLEVLRVIQYCTEALGQPHCFHPPCILFLLELLTCQKDFTNYFSHLEGCGAHLH
REIRDTYYQFVLFLVKAVKGFSSINDRSLLPALSCVQTALLHLLDMGWEPSDLAFFVDIQ
LPHLLMKMSQENISVHDSVISQWSEEDELANAKQNSEWMDECQDGMFEAWYEKIGQEDAE
KQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQCSDMDLCKTCFLGGVKPEGHGD
DHEMVSMEFTCDHCQGLIVGRRMNCNVCEDFDLCYGCYAAKKYSYGHLPTHSVTAHPMVT
VRISDRQRLIQPYVHNYAWLLFAALALYSAHLASAEDVDGEKLDPRDRSSASTLRSQCMQ
LVGDCLMQAHQGKGLKALALLGILPDGDSGPESRAPPDSVPACPLREERAVQGAE
Download sequence
Identical sequences G1M7D8
ENSAMEP00000015258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]