SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015265 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015265
Domain Number 1 Region: 191-367
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-33
Family APC10-like 0.0026
Further Details:      
 
Domain Number 2 Region: 1805-1865
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000612
Family ZZ domain 0.0077
Further Details:      
 
Domain Number 3 Region: 1763-1814
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000589
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 77-145
Classification Level Classification E-value
Superfamily EF-hand 0.00000475
Family Polcalcin 0.071
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000015265
Domain Number - Region: 1104-1178
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00236
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 
Domain Number - Region: 2693-2782
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0327
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015265   Gene: ENSAMEG00000014465   Transcript: ENSAMET00000015897
Sequence length 2948
Comment pep:known_by_projection scaffold:ailMel1:GL193983.1:292716:387015:1 gene:ENSAMEG00000014465 transcript:ENSAMET00000015897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAAAPDARDRDSMGNAPSQSSEDEAAAAGGEGWGSHQDWAADSGXXXXXXXXXPCESLVS
RHHGALLRWLEERLGRGEESVTLEQFRELLEARGAGCSGEQFEEAFAQFDAEGDGTVDAE
NMLEALRNSSGANLQGELSHIIRQLQACSLVPGFIDIFSECKEGVGVHASLILRFLHRNR
LSGAAVPCPMLDRCGNVCSMRSSVLKESLDQLLQREKESPGDLTRSPEMDKLKSVAKCYA
YIETSSNPADIDKMTNGETSSYWQSDGSARSHWIRLKMKPDVVLRHLSIAVASTDQSYMP
QQVTVAVGRSASDLQDVRDVHIPSNVTGYVTLLENANISQHYVQVNIKRCLSDGCDTRIH
GLRAVGFQRVKKSGLSVSDASAIWYWSLLTSLVTASMETNPAFVQTVLHNTQKALQHMPP
LSLSPGSTDFSTFLSPSVLEEVDSFLIRITSCCSTPEVELTLLAFALARGSVARVLDSLC
TVTDRLDAQYDASSLISSMASVRQSLLLKYGKPLQLTLQACDVKGKEEKSGPENLLVEPW
TRDGFLTETGKTRASTIFSTGTESAFQVTQIRIMVRRGGIGAQCGLVFAYNSSSDKFHAE
EHFKRFEKYDKWKLQEFRQFVKSRVGCSADGLGEDDPVGWFELEEEWDEADVKVQQCRVA
KYLMVKFLCTRQESAERLGVQGLSISGYLRPLRADAELHVVCAHCRRDGDDSVCGATLLL
KTLQFIQQLAHDLVQQKESGIKYKSFLDFAGLDLQIFWNFYSKLKQNPREECVWAQTLLL
RLLQSCLPVLQRDGPAASEETKPPRQSPGGAAAAKELHTHLCDVVDRVDGDSAPMETLKQ
EVRNTLLNGAAVFFPDRQTRRSRLFAMMNVTEQERKQSLQLTFHSLCTYFSDKDPGGLLL
LPEKGDVADMNSSEVLAGMSTLLSVAARECEMLVLTGAQGEAGSVLFSLFWAVQGSLLSW
CYLQLKSTDSAARGRAADLIDQYVRQVLARMRVILESLLSQYSGKTIVEKLCNSVFSMAA
RQLVIFLLDFCTLDISHCTLLREFSTLIELLRQLCADLEGTPNKLDGETWQQESPVVLHT
WTKESAHNYENNCHDVSVFVSPGATYFEVEFDERCETEKRYDYLEFTDARGGKTRYDTKV
GTEKWPKKVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAVSWALDLQLLVSRLM
GRLAAQCMALKSAHQFGSDMAVPPAKMASVLNSPLWKPVFRHQLSPELGFAASWPTPPRQ
DSKEVKDIPDDPCHHFLLEFAQSDPAQTFCGPFSELFKGFIQACRKQAPKTDIVAGSTID
RAVNAAFAALVCRTPGLYEKLQTHVKSGGSTALSEEFAQVYCLADGIRIWMLEMKQKSLM
NMGTEKEEKHGSGAAEVNPESLAKECIQKSLLLLRFSPVGVSSKESRDRLAGADDTDHLQ
SQDKRPRTSSVLEEHFQASVSPGEAGAPAAGNGGPGSDTRLKLPPGSSPPATELSSATTE
EPSSPSAPARRPPFTRGRLRLLSFRSMEEARPAPTVKEKYPVLKDVLDFIKDQSLSHESV
VKVLALRKAQAQSVLEVLRVIQYCTEALGQPHCFHPPCILFLLELLTCQKDFTNYFSHLE
GCGAHLHREIRDTYYQFVLFLVKAVKGFSSINDRSLLPALSCVQTALLHLLDMGWEPSDL
AFFVDIQLPHLLMKMSQENISVHDSVISQWSEEDELANAKQNSEWMDECQDGMFEAWYEK
IGQEDAEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQCSDMDLCKTCFLGGV
KPEGHGDDHEMVSMEFTCDHCQGLIVGRRMNCNVCEDFDLCYGCYAAKKYSYGHLPTHSV
TAHPMVTVRISDRQRLIQPYVHNYAWLLFAALALYSAHLASAEDVDGEKLDPRDRSSAST
LRSQCMQLVGDCLMQAHQGKGLKALALLGILPDGDSGPESRAPPDSVPACPLREERAVQG
AEDLNSFTFCFQDKRDGPKEVGPLDSKPRSKANEDGVSSMKGPACQTPSSDSPADGGAPT
GHPDAENTVVLSQKPIEERAVTPSPEQVFAECSQKRILGLLAAMLPPIKLDPTVPVIHLE
HVLPLMFQVVISNAGHLNETYHLTLGLLGQLITRLSPAEVDAAVVQVLSAKHTLFASGDG
SVVPDGWKTAHLLFSLGAVCLDSRVGLDWACSMAEILRSLSSAPLWRDVIAAFTDHCVKQ
LPFQLRHTNIFTLLVLVGFPQVLCVGTRCVYVDNANEPHSVIILKHFTEKNRAVIVDVQT
RKRKTVKDYQLVQKGQEGSSSQAQLSQYSQHFAFIASHLLQTSVDSHCPEAVEATWVLSL
ALKGLYKTLKAHGFEETHATFLPTDLLKLLVTRCSKGTGFSKTWLLRDLEILSIMLYSSK
KEIHTLAEHTAPERDERGDQEEEVEGTVSSPGEPEQRKLDPLESLDEPTRICFLMAHDAL
NAPLHILRAIYELQMKRTDSFFLEVQKSRFDGDELTTDERIRTLAQRWQPSRSLRLEEQG
AKAVDTDMIILPCLSRPARCEQATAESNPVAQKLIASTESELQHSYAKQRRSQSAALLHK
ELNCKSKRAVREYLFRVNEATAVLYARHVLASLLAEWPGHVPVSEDTLELSGPAHMTYIL
DMFMQLEEKQQWEKILRNVLQGCHGSMLGAMALAACQFMEEPGMEVQVRESKHPYNNNTN
FEDKVHIPGAIYLSVKFDSQCSTEEGCDELAMSSSSDFQQDRHTFSGSQQKWKDFELPGD
TLYYRFTSDMSNTEWGYKFTVTAGHLGRFQTGFEILKQMLSEDRVVPHLPLGKIWEWLVG
VACRQTGHQRLKAIHLLLRIARCCTHSDLCDLALLKPLWQLFSHMEYSLFEDVTQPGILP
PLHRALTELFFVTENRAQELGLLQDYLLALTTDDHLLRCAAQALQNIAAISLAINYPNKA
TRLWNVEC
Download sequence
Identical sequences G1M7E5
ENSAMEP00000015265 ENSAMEP00000015265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]