SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015710 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015710
Domain Number 1 Region: 159-272
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-35
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 37-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 337-460
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-33
Family Netrin-like domain (NTR/C345C module) 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015710   Gene: ENSAMEG00000014891   Transcript: ENSAMET00000016363
Sequence length 465
Comment pep:known_by_projection scaffold:ailMel1:GL193583.1:249383:254211:-1 gene:ENSAMEG00000014891 transcript:ENSAMET00000016363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAATASLLGPLITAWALLPFAQGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPN
KECIWTITVPEGQTVSLSFRVFDLEQHSACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL
VAPGNQVTLRMTADEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDY
PPGISCSWHIIAPPDQVISLTFGKFDLEPDTYCRYDSVSVFNGAVSDDAKRLGKFCGDTA
PGPISSEGNELLVQFVSDLSVTADGFSASYKTQPRGAEGQARSPGEDARLGTSLPKPGLP
SAEKPKASSEAQATPEDPGGSPSTNSTPSLLDVPTVSCPKQCRRTGTLQSNFCSSSLVVT
ATVKSMVRGPGEGLTVTVSLIGAYKTGGLDLPSPLTDTPLKFYVPCKQCPLMKKGASYLM
MGQVDENRGPVLPADSFVVLYRSSQDQILSNLSKRKCPSQPVPAA
Download sequence
Identical sequences G1M8P0
ENSAMEP00000015710 ENSAMEP00000015710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]