SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000016133 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000016133
Domain Number 1 Region: 646-709
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000283
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 566-614
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000654
Family TSP-1 type 1 repeat 0.00049
Further Details:      
 
Domain Number 3 Region: 19-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000419
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 4 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 700-757
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000445
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000016133   Gene: ENSAMEG00000015230   Transcript: ENSAMET00000016806
Sequence length 938
Comment pep:known_by_projection scaffold:ailMel1:GL192928.1:24781:79022:1 gene:ENSAMEG00000015230 transcript:ENSAMET00000016806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARHSILYFILLSALIDKCQPCFCDHYPWGQWSSCSKSCNSGTQSRQRKIVVDQYYLDNF
CDQLCTKPETRECNWQRCPINCLLGDYGPWSDCDPCVEKQFKVRSILRPSQFGGQPCTEP
LVTFRPCIPSKLCKIEEVDCKNKFRCDSGRCISSKLECNGENDCGDNSDERNCGRTKAVC
PGKKQHIPIPSVQLMGAGYHFLAGEPRGEILDNSFTGGICKTVKSSRASNPYRVPANLEN
VNFEVKTEEDDLETDFYKDLIPLTKKENQQALFSREERDSFHIPIFYSSKKTQSTTHNSA
FKQAIEASHRKDSSFTRVHKVIKVLNFTMKTEDLQLSDVFLKALNHLPLEYNFALYSRIF
DDFGTHYFTSGSLGGVYDLLYQFSLEELRNSGLTEEEIRNCVRIETKKRRFGFKKTKVEH
RCTTNKMSEKYEGSVLQGAEKSISLTRGGRSKYAAALVWEKGNSGPAEKEFSEWLESVKE
NPAVIDFELAPITDLVRNIPCAVTRRSNLKKAFREYAAKFDPCRCAPCPNNGRPTLSGTE
CLCVCQSGTYGDNCERRSPDYKSNAVDGSWSCWSSWSTCDATYKRSRTRECNNPAPQQGG
KPCEGEKRQEEHCTFSIMENNGQPCVSDDEEVKEIDLPETESDSGCPRPVPPENGFIRNE
KKLYSIGEEVEISCFTGFTAIGYQYFRCLPDRTWRRGDVECQHTQCLKPVVQEILTISPF
QRLYEIGESIELTCPRGFAVAGPSRYTCSEDSWTPPISDSLTCEEVSDVLTKLKGRCQPG
QKQLGSECICMSPEEDCSHYSEDLCVFDTDTSHYFTSSACKFLAEKCLNNQHLDFLHIGS
CQDGPQLEWGLERRKLSSNSTKKESCGYDTCYDWEKCSASISKCVCLLPPQCFKGGSQLY
CVKMGSSTSEKTVSICEVGAIRCANRKVEILYPGRCSA
Download sequence
Identical sequences G1M9W0
ENSAMEP00000016133 ENSAMEP00000016133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]