SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000016318 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000016318
Domain Number 1 Region: 279-438
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.05e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000294
Further Details:      
 
Domain Number 2 Region: 69-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-31
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 3 Region: 179-276
Classification Level Classification E-value
Superfamily LCCL domain 2.48e-23
Family LCCL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000016318   Gene: ENSAMEG00000015456   Transcript: ENSAMET00000016994
Sequence length 763
Comment pep:known_by_projection scaffold:ailMel1:GL193290.1:412021:489278:1 gene:ENSAMEG00000015456 transcript:ENSAMET00000016994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEQAAASARSAWAEAVLPLSRPLPPRSNSSSSFPMPMFLLLLLILVLLLEDAGAQQGDGC
GHTVLGIESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLR
IYNGIGVSRTEIGKYCGLGLQMNHSIESKSNEITVLFMSGIHVSGRGFLASYSVIDKQDL
ITCLDTASSFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNILGG
QISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASS
VLEWTDHTGQENSWKPEKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIVTTGSTMV
EHNYYVSAYKVLYSDDGQRWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVN
PTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQP
LQPRSNNEFPAQTEQTTATPDIRNTTVTPSVTKDVALAAVLVPVLVMVLTTLILVVVCAW
HWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKSVEHEETPVRYSSSEVNHLSPREVPT
MLQTDSAEYAQPLVGGIVGTLHQRSTFKPEEGKEASYADLDPYNSPVQEVYHAYAEPLPI
TGPEYATPIVMDMSGHPTASVGLPSTSTFKATGNQPPPAVGAYNTLLSRTDSCSSARAQY
DTPKGGKPGASAPDELVYQVPQCTQEASGAGRDGECDVFKEIL
Download sequence
Identical sequences G1MAE4
ENSAMEP00000016318 ENSAMEP00000016318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]