SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000016929 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000016929
Domain Number 1 Region: 27-127
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-31
Family V set domains (antibody variable domain-like) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000016929   Gene: ENSAMEG00000016044   Transcript: ENSAMET00000017625
Sequence length 132
Comment pep:novel scaffold:ailMel1:GL195619.1:8914:9430:-1 gene:ENSAMEG00000016044 transcript:ENSAMET00000017625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRVCVTMAWTLILLVLLSHRAGSLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYYM
YWYQQKPGSPPRYILCHKSGADKHQGSGIPSRFSGSKDASANEWFLLISGLQPEDEADYY
CALYHYIGNDYH
Download sequence
Identical sequences G1MC51
ENSAMEP00000016929 ENSAMEP00000016929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]