SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018018 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018018
Domain Number 1 Region: 177-257
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.14e-25
Family PHD domain 0.0000521
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000018018
Domain Number - Region: 12-104
Classification Level Classification E-value
Superfamily NAP-like 0.068
Family NAP-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018018   Gene: ENSAMEG00000017057   Transcript: ENSAMET00000018749
Sequence length 279
Comment pep:known_by_projection scaffold:ailMel1:GL193164.1:438323:444094:1 gene:ENSAMEG00000017057 transcript:ENSAMET00000018749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDEYYEKFKR
ETDGVQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAHQEVN
DTTGHSGKAGQDKSKSETITQAEKTNNKRSRRQRNNENRENAANNHDHDDITSGTPKEKK
AKASKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC
VGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
Download sequence
Identical sequences G1MF89
ENSAMEP00000018018 XP_002924658.1.58354 ENSAMEP00000018018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]