SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018282 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018282
Domain Number 1 Region: 2-355,385-405
Classification Level Classification E-value
Superfamily Thiolase-like 3.43e-72
Family Thiolase-related 0.0025
Further Details:      
 
Domain Number 2 Region: 2180-2453
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.27e-63
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000777
Further Details:      
 
Domain Number 3 Region: 1594-1758
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.09e-41
Family Alcohol dehydrogenase-like, C-terminal domain 0.00011
Further Details:      
 
Domain Number 4 Region: 495-620,683-780
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.62e-40
Family FabD-like 0.0042
Further Details:      
 
Domain Number 5 Region: 1837-2025
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.89e-33
Family Tyrosine-dependent oxidoreductases 0.0002
Further Details:      
 
Domain Number 6 Region: 1510-1629
Classification Level Classification E-value
Superfamily GroES-like 0.00000000000000152
Family Alcohol dehydrogenase-like, N-terminal domain 0.0045
Further Details:      
 
Domain Number 7 Region: 1218-1357
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000844
Family Plant O-methyltransferase, C-terminal domain 0.072
Further Details:      
 
Domain Number 8 Region: 2080-2144
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000864
Family Acyl-carrier protein (ACP) 0.00015
Further Details:      
 
Domain Number 9 Region: 620-678
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000798
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018282   Gene: ENSAMEG00000017256   Transcript: ENSAMET00000019022
Sequence length 2464
Comment pep:known_by_projection scaffold:ailMel1:GL192350.1:161063:176536:1 gene:ENSAMEG00000017256 transcript:ENSAMET00000019022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESDNMQEFWANLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLTKF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAILDGGINPASLRGTHTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRISFSFDFKGPSIALDTACSSSLVALQSAYQAIRRGEC
PWAIVGGINTLLKPNTSVQFMKLGMLSPEGSCKSFDESGNGYCRSEAVVVMLLTKKSLAR
RVYATILNAGINTDGCKEQGVTFPSGEAQEQLMRSLYEPAGLDPGSLEYIEAHGTGTKVG
DPQELNGIDRALCTTRQDPLLIGSTKSNMGHPEPVSGLAALAKVLLSLENGVWAPNLHFC
SPNPEIPALREGRLQVVDRPLPVRGGNVGINSFGFGGSNVHVILRPNLQPPSPSTPHVTL
PRLLRASGRTPEAVRCLLEQGHQHGQDAAFLSMLNDIAASPPSAMPFRGYTVLGAEDSSL
ELRDAQQPPTGQRPLWFICSGMGAQWRGMGSSLMRLDSFRDSILRSDEAVKPLGLQVSKL
LLSEDEATFDDLVHSFVCLTAIQIALIDLLTSMDLRPDGIIGHSLGEVACGYADGCFSQE
EAVLTAYWRGQCIKEANIPPGAMAAVGLSWEECKQRCPPGIVPACHNSEDTVTISGPQAE
MAAFMEQLKQEGVFAKAVRTGGMAFHSYFMESIAPTLLRALKKVIREPKPRSARWLSTSI
PEAQWKGSLARTCSAEYSVNNLVSPVLFQEALCHVPEHAVVLEIAPHALLQAVLKRGLKA
SCTILPLMKRDQRDNLEFFLRNVGKLHLLGIDANPNGLFPPVEFPVPRGTPLISPHIKWD
HSQVWDVPAAGDFPNGSRGQPPSTTSTDTSPESPDHYLVDHCIDGRILFPATGYLCLAWK
MLARALSQNMEDVPVVFEDVTLHQATILPKSGTVALEVRLLEASRTFEVSQNGNLIVSGK
VYQWEDPDPKLFDSRDVPDPADPTDPTATFRLSQGDVYKELRLRGYDYGPYFQGILETNL
EGNTGQLLWKDNWVTFLDTMLQISILGVVQRTLRLPTRITSIHIDPATHRQKVYSLKGQA
QVADVVVSSCLKSTAAGGVLISGLHASTAPRRQQEQLAPTLEKFCFTPHVEGGLLAGNAA
LQEELQLCRGLAQALQTKVAQQGLKMVVPGLDGAQVPREPPQQGLPQLLAAACQLNGSLQ
LELDQLLAQERPLLHDDPLLSGLLDSPALKACVDTAVENLTSPRMHIVEVLAGDGRLYSR
VPALLNTQPMLQLDYTATDRHPQALEAAQAKLQEHGIAQGQWDPADPAPSSLGAADLLVC
NCAVAPLRDPAAALGNMAAALKEGGFLLLHVLLRGHPLGETVAFXRPAPQDSPVFLPVED
TSFRWVDSLKNVMADSSSRPVWLTAVSCATSGVVGMVNCLPATHRCILVSNLSSTSPIPK
MDPSSSELQKVLQGDLVMNVYRDGSWGAFRHFPLERGLPEEQTEHAFVNVLTRGDLSSIR
WVCSPLRHVQPTEPGVHLCTVNYASLNFRDIMLATGKLSPDAIPGKWAARQCMLGMEFSG
RDASGKRVMGLVPAEGLATSVVLSQDFLWDVPSGWTLEEAASVPVVYTTAYYSLVVRGRM
RRGETVLIHSGSGGVGQAAITIALSLGCRVFTTVGSAEKQAYLQARFPQLNDASFANSRD
TSFEQHVLRHTAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHQLGMAIF
LKNVTFHGILLDSLFDEASSEWREVAGLLQAGIRDGVVQPLKCTTFPKHQVEDAFRYMAQ
GKHVGKVVVQVLEEQEAVPQVTRPLLMTAVSKTFCPPHKSYVITGGLGGFGLELAQWLVL
RGAQKLVLTSRSGIRTGYQAKQVHEWRRQGVQVLVSTSNASSLDGARSLIAEATQLGPVG
GVFNLAMVLRDAMLENQTPEFFQDVSKPKASGTVNLDRVTRAACPELDFFVVFSSVSCGR
GNAGQANYGFANSTMERVCEKRRRDGLPGLAVQWGAIGDVGIVLETMGSNDTVIGGTLPQ
RIASCLEVLDLFLSHSHPVLSSFVLAEKKATAQGDGSAHQDLMKVVAHILGIRDLATVNL
DSTLADLGLDSLMGVEVRQMLEREHDLVLSMRDIRQLTLRKLQELSSKAGTADELGAPTP
KDGSSTGQQAQLNLSTLLVNPEGPTLTRLNSVQSSERPLFLVHPIEGSITVFHSLAAKLS
IPTYGLQCTRAAPLDSIQSLAAYYIECIRQVQPEGPYRIAGYSYGACVAFEMCFQLQTQQ
SPAPTHNSLFLFDGSHTYVLAYTQSYRAKMTRGCEAEAEAEAMCFFLQQFIDMEHDRVLE
ALLPLGGLEERVAAASVKRSHTGLDRRELSFAARSFYHKLRAAEEYAPRATYHGNVTLLR
AKTSSVYGEGLGADYSLSQVCDGKVSVHVIEGDHRTLLEGSGLDSIVSIIHGSLAEPRVS
VREG
Download sequence
Identical sequences G1MG00
ENSAMEP00000018282 ENSAMEP00000018282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]