SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018325 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018325
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.2e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000643
Further Details:      
 
Domain Number 2 Region: 428-585
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000672
Further Details:      
 
Domain Number 3 Region: 645-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-37
Family MAM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 146-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-33
Family Spermadhesin, CUB domain 0.00000129
Further Details:      
 
Domain Number 5 Region: 34-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-32
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018325   Gene: ENSAMEG00000017302   Transcript: ENSAMET00000019066
Sequence length 924
Comment pep:known_by_projection scaffold:ailMel1:GL193064.1:643330:775301:1 gene:ENSAMEG00000017302 transcript:ENSAMET00000019066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGLPLLCAALAVALALASAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENENGRLWGKFCGKIAPSPVVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTAPSGVIKSPGFPEKYPNSLECTYIIFAP
KMSEIILEFESFDLELDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYRI
DISSNGEDWITIKEGNKPVIFQGNTNPTDVVFGVFPKPLITRFVRIKPVTWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITASNQGERNWMPENIRLVTSRSGWALPPAPHPY
VNEWLQVDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRTFPPLSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLV
DECDDDQANCHSGTGDDFQLTGGTTVLTTEKPTIIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDNHVQLKWSVLTSKTGPIQDHTAGDGNFIYSQADENQKGKVARLVSPVVYSQNSA
HCMTFWYHMSGAHVGTLRVKLHYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQV
IFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKRNPENKIDETGSTPGYEGPGEG
DENISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENY
NFELVDGVKLKKDKLNTQSTYSEA
Download sequence
Identical sequences G1MG43
ENSAMEP00000018325 ENSAMEP00000018325 XP_011228781.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]