SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019068 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019068
Domain Number 1 Region: 562-672
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 385-496
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-20
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 3 Region: 679-744
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000076
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 214-322
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000051
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 5 Region: 738-800
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000653
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 806-865
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000011
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 326-387
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000486
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 501-565
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000054
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019068   Gene: ENSAMEG00000018043   Transcript: ENSAMET00000019829
Sequence length 958
Comment pep:known_by_projection scaffold:ailMel1:GL192943.1:646157:902640:1 gene:ENSAMEG00000018043 transcript:ENSAMET00000019829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENRGSKAADTNQSSKETTMELATMECLLVALWSLSALSPILSQWASPPRALPSGKKPPSL
KQVNSARKQLRPKATSTAAVQRAANPPASPGLGLLSSATEKLRPPGDPEPSASEEPRWLD
RKAGAVPTTPAPLQISPFTSQPYVAHTLPQRPDPGEPVAPDDAPEAPPEDASPMTLMDKG
ENELTGSASEESQETTTTTIITTTVITTEQAPAPCSVSFSDPEGYIGSSDYPPLPLSGFL
ECTYNVTVYTGYGVELQVKSVNLSDGELLSIRGVDGPTLTVLANQTLLVEGQVIRSPTNT
ISVYFRTFQDDVLGTFQLHYQAFMLSCNFPRRPDYGDVTVMDLHPGGVAHFHCHLGYELQ
GAKTLTCMNASKPHWSSQEPVCSAPCGGAVHNATIGRVLSPSYPGNTNGSQFCVWTIKAP
EGQKLHLHFERLSLHEKDRMMVYSGLINKSALLYDSLQTENVPFEGLLSEGNGIRIEFLS
DQARAASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTVVEFTCDPGHSLEQGPAI
IECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVEGEDCIWKIHVGEEKRI
FLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQFHSDPAGLIF
GKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARVTYQCDPGYDIVGSDTLT
CQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLL
TCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFE
LMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVAETAAETSLEGGNMALAIFIPVL
IISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences G1MI83
ENSAMEP00000019068 ENSAMEP00000019068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]