SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001336 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001336
Domain Number 1 Region: 280-528
Classification Level Classification E-value
Superfamily SIS domain 8.45e-21
Family mono-SIS domain 0.0064
Further Details:      
 
Domain Number 2 Region: 29-278
Classification Level Classification E-value
Superfamily SIS domain 0.0000000489
Family mono-SIS domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001336   Gene: ENSAMEG00000001253   Transcript: ENSAMET00000001388
Sequence length 625
Comment pep:known_by_projection scaffold:ailMel1:GL192369.1:463160:487028:-1 gene:ENSAMEG00000001253 transcript:ENSAMET00000001388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGKWELSGYEAALPITEKSNPLTQDLDKADAEQIVRLLGQCDAEI
FQEEGQVMPTYQRLYSESVLTTMVQVAGKVQEVLKEPEGGLVVLSGGGSSGRMAFLMSVS
FNQLMKGLGQKPLYTYIIAGGDRSVMASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDYCMDNPAIFLPVLVGFNPVNMARNDPIEDWSSTFRQIAERMQKLQEKQ
EAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDRGIAASQRCLLEILRTFE
RAHQVTYSQSPKIAALMKQASTSLEKKGRVYLVGWQTLGIIAIMDGVECIHTFGADFRDV
RGFLIGDHSDMFSQKAELINQGPQFSFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQ
TLVEQVKEKTANIQALAHSTVGQTLPTPLKKLFTSIISITWPLLFFEYEGNFIQKFQHEL
STKWVLNTVSTGAHVLLGKILQNHMLDLRIRNSKLFWRALAMLQRFSGQPKARCIETLLQ
VIHFPQPLSDGIRAAPISLHVQVAHEKEQVIPTALLSLLSRCSIPEAQAQLAAAPSVCEA
VRSALTGPGRKRVADPLETLEPALL
Download sequence
Identical sequences G1L376
ENSAMEP00000001336 ENSAMEP00000001336 XP_002913853.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]