SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001980 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001980
Domain Number 1 Region: 51-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-34
Family SCAN domain 0.00015
Further Details:      
 
Domain Number 2 Region: 223-283
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 754-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 671-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 504-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.9e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 829-889
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-16
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 588-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000125
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 8 Region: 465-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000304
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 878-913
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000155
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000001980
Domain Number - Region: 635-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0476
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001980   Gene: ENSAMEG00000001882   Transcript: ENSAMET00000002059
Sequence length 955
Comment pep:novel scaffold:ailMel1:GL195185.1:8079:15385:-1 gene:ENSAMEG00000001882 transcript:ENSAMET00000002059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGRWYAVHPVQAQASRERGRLQMVKKEEEDEGYTSVQAARPQTLNRSGQELFRQLFRQ
LRYHESSGPLETFSRLRELCRWWLRPDILSKAQILELLVLEQFLSILPGELRTWVQLHHP
ESGGEAVALLEELQRDFDGTPWRDPTLAQSPDVRWMGTGALRASQIWPPASPLRSSSTLG
DHLEPPYEIGVCDFLAGQSEPPVAEVPALSQREVCPGDTLTSQPQEAVTFKDVEVTFSQD
EWGWLDPAQRNLYRDVMLENYRNVVSLVGPFTKPVLISWLEAREPWGLNAQGAQPKGNLG
VAPAGGELQIKTNKFILKHEPLEEAETLAGPSECWRTSVSEGMGLRESFEKKSRLKEQCG
NPVQVRVKKEETNVSHRTEKELEESGRSTSHNLKHATYLRVPRRKRSLKHGCGRHFRGSS
YHYDYKEYGKGLRRIVGGFSLHQRIHAGLKANAKDARGKDFSLSSHHQRQNLHMGTSYKC
GDCGRTFSHSSHLACHQRLHTQEKPFKCRVCGKAFRWSSNCVRHEKIHTGVKPYKCSLCD
KAFRRMSAYRLHQETHAKQKFLESNQHEEALTYSSGFDHHLRDQSGEKPFDCSQCRKSFH
CKSYVVEHQRVHTQEKPYKCTKCRKTFRWRSNFTRHMRMHQEEKFYDQDTCREDFRQTSS
CSQSQSAPVTEKAFPCQQCGKTFTRKKSLIDHQRIHTGEKPYRCSECEKQFTHRSAFIAH
KKQHAIQRKPEDGPSFNQDRVLQVPQSSQTTEEAYKCSQCGKAFRNHSFLLIHQRIHTRE
KPYKCRECGKAFRWSSNLSRHQRIHSLEKQYEYRESGNTPNLQSQMLAGEKPFWCQECGK
TFTRKRSLLDHKGIHSGEKRYKCNLCGKSYDRKHRLVNHQRIHSKERPFKCQWCGKDFIG
RHTLCIHQRKHTRVAQSECSLAGLSSCQDTGVSLQELKPSGEKPLEDSAEACDQS
Download sequence
Identical sequences G1L520
ENSAMEP00000001980 ENSAMEP00000001980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]