SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002007 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002007
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000001
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 487-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000027
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 721-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000417
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 539-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000321
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 629-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000127
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 582-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000414
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 784-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000892
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000002007
Domain Number - Region: 139-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00609
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 179-312
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.0114
Family Galactoside acetyltransferase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002007   Gene: ENSAMEG00000001872   Transcript: ENSAMET00000002087
Sequence length 892
Comment pep:known_by_projection scaffold:ailMel1:GL193319.1:508615:514483:-1 gene:ENSAMEG00000001872 transcript:ENSAMET00000002087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGGRRLPGSSKSGPGKDGGRNEVRLPVLHDPPKLGMPVVRGGQTVPSQAPLCF
DPGSPASDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSI
YGLKYHYQRCQGGAIPERLTFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPAPKPGPVSRP
VTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVTVSRPVPVTKPIPVTKSVPVSRP
VPVTKPIPVTKSVPVSRPVAVTKSVPVTKPVTINKPVPMTKLVTVTKPVPVTKPVTVSRP
IVVSKPVTVSRPIAISRHTPPCKMVLLTKSENKTPRATGRSSGKKRAADGLDACPVLPKQ
ARPENGEYGPSTTGHSSAFQLSTDPSGSPPSLGSRLLGSKEAPRATGPVSPEEGAERTKH
RRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKSRMHRAKKQEGPGPEDVRKKALAPASTV
SKEVPAPTAHPAPGGPEEPWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDAL
KCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEASEGSEQEERERLRKVLKQMGRLRCPQEG
CGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHMRSEHTAPPPEE
PEDKPPETEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRVKDDLVPETA
RLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGEHL
VGKYCCLLCPKEFSSESGVKYHILKTHAENWFRTSADPLPKHRSQDSLAPKKEEKKSLAG
GKKRGRKPKERTPEEPAPKMPPRRDDWPPGGRDKGARGSTGRKGGASKAPEK
Download sequence
Identical sequences G1L547
ENSAMEP00000002007 ENSAMEP00000002007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]