SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003339 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003339
Domain Number 1 Region: 3115-3427
Classification Level Classification E-value
Superfamily BEACH domain 3.01e-112
Family BEACH domain 0.00000011
Further Details:      
 
Domain Number 2 Region: 3545-3792
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.25e-34
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 3 Region: 3017-3120
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-21
Family PreBEACH PH-like domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000003339
Domain Number - Region: 1541-1695
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0076
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number - Region: 242-313,394-487,571-685,727-830
Classification Level Classification E-value
Superfamily ARM repeat 0.0164
Family Armadillo repeat 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003339   Gene: ENSAMEG00000003100   Transcript: ENSAMET00000003471
Sequence length 3806
Comment pep:known_by_projection scaffold:ailMel1:GL193802.1:91758:242164:-1 gene:ENSAMEG00000003100 transcript:ENSAMET00000003471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIDSNSLAREFLTDVNRLCNAVIQRVEAREEEEEETHMATLGQYLVHGRGFLLLTKLNS
IIDQALTCREELLTLLLSLLPLVWKIPVQEEKATDFNLPFSADIILTKEKNSSSQRSTQE
KLYLEGSAPSGQVSATVNVFRKSRRQRKTTHRYSIRDARKTRLSTSDSEANSDDKSVAMN
KHRRPRLLQHFVTQSPKDDHLTAKLDHLSTKEQTPPDTMALENSKEVIPRQESDSDILSE
PAALSIISHMNNSPFDLCHVLLSLLEKVCKFDMTLNRNSALAATVVPTLTEFLAGFGDCC
NLSDNLESQMLSTGWTEEPVALVQRMLFRTVLHLMSVDISTAEMMPENLRKNLTELLRAA
LKIRTFLEKQPDPFAPRQKRTLQEVQEGFVFSKYRHRALLLPELLEGVLQILICCLQSAA
SNPFFFSQAMDLVQEFIQHHGFNLFETAVLQMEWLVLRDGVPTEASEHLKALINSVMKIM
STVKKVKSEQLHHSMCTRKRHRRCEYSHFMHHHRDLSGLLVSAFKNQVSKNPFEETADGD
VHYPERCCCIAVCAHQCLRLLRQASLSSTCVQILSGLQSVGICCCMDPKSVIIPLLHAFQ
LPALKHFQQHILNILNKLILDQLGGAETPQKIKQAACNICTIDPDQLAKLEETLQGNSCD
AAPSPNLSSPSYRFQGILPSSGSEDLLWKWDALEVYQKFVFEEDRLCSVQIANHICNLIQ
KGNVVVQWKLYNSVFHPVLQRGAELAHHCQHLSITSAQTHVCSHHNQCLPQEVLQIYLKT
LPALLKSRVIRDLFLSCNGVNQIIELNYLDGIRSHSLKAFETLIISLGEQQKDSSIPGTD
GLDIEQKELSSLNVDTSFRNQQAYSDSPQSLSKFYASLKEAYPKKRKSVNQDVHINMINL
FLCVAFLCVSKEAESDRESANDSEDTSGYDSTASEPLRHILPCLSPESLVLPSPKHMHQA
ADIWSMCRWIYMLSPVFQKQFYRLGGFQACHKLIFMIIQKLFRSHEEEQGKREGDINIRA
NQDVNRTSQSEITMKEDLLSLTVKRDPTPSELGSLNKSADSVSKLELQHISSINVGHISA
AEAAPEEAKVFTSQESETSLQSIRLLEALLAICLHSSRASQQKVELELPNQNLSVENILF
EMRDHLSQSKVIETELAKPLFDALLRVALGNHSADFEHHDAMTEKSHQSEELSSQPGDFS
EEADDSQCCSLKLLVEEEGYEADSESNPEDSETRDDGVDLKPEAEGFNTVSSPKEDLLEN
LTEGEIIYPEICMLELNLLSTGKAKLDVLAHVFESFLKIIRQKEKNIFLLMQQGTVKNLL
GGFLSILTQADSDFQACQRVLVDLLVSLMSSRTCSEELTLLLRIFLEKSPCTEVLLLGIL
KIIESDITMSPSQYLTFPLLHTPNLSNGISSQKCPGILNSKALGLLRRARSSRSRKESDS
TSFPQQLLSSWHVAPVHLALLGQNCWPHLSEGFSVSLWFNVECTHEAERTMEKGKKTKKR
NKSLILRDSSLDRTENNRPEGAEYINPGERLIEEGCIHMISLGSKALMIQVWADPRNGTF
IFRMCMDSNDDTKAVLLAQVESQENIFIPSKWQHLVLTYLQQPQGKKNNHGKISIWISGQ
RKPDVTLDFVLPRRTSLSSDSNKTFCMIGHCLSSQEEFLQLAGKWDLGNLLLFSGAKINS
QEAFYLYACGPNHTSIMPCKYGKPVNDYSKYISKEILQCEQIRELFMTKKEVDIGLLIES
LSVVYTTNCPAQYTIYEPVIRLKGQMKTQLAQRPFSSKEVQSILLESHHLKNLRPTECKT
IQGILHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLTKYNQQRIHELENCNGLSM
IHQVLIKQKCIVGFHVLKTLLEGCCGEDIIHVHENGEFKLDVESNAIIQDVKLLEELLLD
WKIWNKAKQGAWETLLVALEVLIRADHHQQVFNIKQLLKARVVHHFLLTCQVLQEHKEGQ
LTSMPREVCRSFVKIIAEVLGSPPDLELLTVIFNFLLAVHPPTNTYICHNPTNFYFSLHI
DGKIFQEKVQSIMYLRHSSSEGKSVPSPGFMVITPSGFTASPPEAGNSSCNIIPQWMTTN
RLRSRSLPAFPTISPRMQPQKLTGSLGYSIDKLQNIADNYVASQAEKLNSLVSSETLKKG
KKDVFVSSFESSKAVCEMEVTLSARTSVNGVPKGTLGFPGVKVDHKELAAEPRSDEDSPG
EESCPRRPDYLKGLASFQRSHSTIASLGLAFPPQNGSAAVGRWPSLVDRNTDEWENFAFS
LGYEPNSSQTASTHSVTEDCLVPICCGLYELLSGVLLILPDVMLQDVMDKLIQADTLLVL
VNHPSPAIQQGVIKLLDAYFNRASKEQKDKFLKNRGFSLLANQLYLHRGTQELLECFIEM
FFGRRIGLDEEFDLEDVKNMGLFQKWSVIPVLGLIETSLYDNMLLHSALLLLLQILNSCS
KVADMLLDNGLLYVLCNTVAALNGLEKNVPLNEYKLLACDIQQLFIAVTIHACSSSGAQY
FRVIEDLIVLLGYLQNSKNKRTQTKNMAVALQFRVLQAAMEFIRTTANHDSENLADTFQL
PSAPHHAVFQKRKSIAGPRKFPVAQTDSLLMKMRSVASDELHVMMQRRMSQENPVQATET
ELAQRLQRLTILAVNRVIYQVKEFNPDVIDILSTPENATQSKISVSQTEISEEDVHHEQP
SMFNPFQKEILTYLVEGFKVSIGSSKTSGSKQQWPKILWSCKETFRMQLGRLLVHILSPA
HSSQERKQIFEIVREPNHQEILRDCLSPSLQHGAKLVLYLSELIHNHQDELTEEELDTAE
LLMNALKLCGQKCIPPSATTRADLIKMIKEEQKKYETEEGTNKATWQKTVNNNQQSLFQR
LDSKSKDISKIAADITQAVSLSQGIERKRVIQHIRGMYKVDLSASRHWQELIQQLTHDRA
AWYDPLYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLRDRQKSEDVVKPPLSFLFED
KTHSSFSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTVESSS
LQGELEPASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHSIL
TNNLPNLLEYGNISALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVS
ETLDLSDPSVYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGS
HYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIP
EFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNIC
QWIDLVFGYKQKGKASVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLF
QSAHASRPGSKLNLEGELPAAVGLLVQFAFRETREQVKEITYPSPLSWIKGLKWGEYVGS
PSAPVPVVCFSQPHGERFGSLQALPTRAICGLSQNFCLLMTYSKEQGVRSMNSTDIQWSA
ILSWGYADNILRLKSKQSEPPINFIQSSQQYQVTSCAWVPDSCQLFTGSKCGVITAYANR
FTSSTPSEIEMESQIHLYGHTEEITSLFVCKPYSIMISVSRDGTCIIWDLNRLCYVQSLA
GHKSPVTAVSASETTGDIATVCDSAGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPE
GVSINVIAGGLENGIVRLWSTWDLKPVREITFPKSNKPIVSLTFSCDGHHLYTANSDGTV
IAWCRKDQQRLKQPMFYSFLSSYAAG
Download sequence
Identical sequences G1L8X0
ENSAMEP00000003339 ENSAMEP00000003339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]