SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003578 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003578
Domain Number 1 Region: 1013-1104
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-25
Family PDZ domain 0.00028
Further Details:      
 
Domain Number 2 Region: 395-499
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-23
Family PDZ domain 0.0000581
Further Details:      
 
Domain Number 3 Region: 839-937
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-23
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 699-810
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-22
Family PDZ domain 0.00045
Further Details:      
 
Domain Number 5 Region: 123-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 6 Region: 552-662
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-16
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 7 Region: 289-326
Classification Level Classification E-value
Superfamily WW domain 0.000000000000341
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 337-371
Classification Level Classification E-value
Superfamily WW domain 0.00000000127
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 16-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000171
Family PDZ domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003578   Gene: ENSAMEG00000003390   Transcript: ENSAMET00000003719
Sequence length 1479
Comment pep:known_by_projection scaffold:ailMel1:GL192586.1:334835:568543:-1 gene:ENSAMEG00000003390 transcript:ENSAMET00000003719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLREEPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAVNGSGTAENRERHSESSDWIKTIPSYNQTNSSMDFRNYMMRDENLEPLPKNWE
MAYTDTGLVYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQAETGSSKADMEKSHFTRDPSQLKGILIRASLKKSTMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVSLTLCRGYPLPDDSEDSVADIVAATPVINGQSLTKGETCMNTQDFKSGAVVLDQ
NGKPGPTLISDRLNGPSDLSEQRASLASSGGSQPELVTIPLMKGPKGFGFAIADSPAGQK
VKMILDSQWCQGLQKGDIIKEIYHQNVQSLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTAKMKTDKKENSGSLEAINEPIPQPMPFPPSIVRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGEGPDQSIYIGAIIPLGAAERDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEEDSSQAFLSTQNGSPRLTRAEL
PARPALQEAYDVLLQRKENEGFGFVILTSKSKPPPGVIPHKIGRVIEGSPADRCGKLKIG
DHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVVAEEEHHGPPSGTNSARQSPALQHRP
MGQSQPNHIPGDRSALEGEIGKDGSTSYRHSWSDHKHLAQPDTAMISVVGTRHNQSLGCY
PVELERGPRGFGFSLRGGKEYNMGLFILRLAEEGPAIKDGRIHVGDQIVEINGEPTQGIT
HTRAIELIQAGGNKVLLLLRPGTGLIPDHGDRDVNPASSNVIYDELPPFPPSSHSASVLE
GSPVPVTEESFMRVQICEKTEELKDGVPEKKSTLNENPSDKKHSFLQKNVNKRDPPSSQG
QSDKKNPFRVENGVTQRGRSVSPRKPTGRHAEGPSDQLPSPLPADPKRRPRDRSLSPRKG
DSKGGQMGTRAGSGQDHCGRSRGWSSSPKKQQKTEGSKGRSNAEARLLGAESQRGGGRAK
DGAEQISEGREESGVVRKDTKQSQSGKNRTRSPEKKSKRMDDKSLPSKKTSTAASRVLSD
REKGKKATLGETSSSKEKTGENARTSDKKLKQDPEERTVLNKIQAPRGKEQEAADRSRES
GGFQPESASPVKKTPITPGPWKVPSANKAAGTTGVAEKR
Download sequence
Identical sequences G1L9K5
ENSAMEP00000003578 ENSAMEP00000003578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]